KEGG   Lactobacillus plantarum WCFS1: lp_0910
Entry
lp_0910           CDS       T00115                                 

Definition
(RefSeq) DNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03420  Nucleotide excision repair
lpl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    lp_0910
   03430 Mismatch repair
    lp_0910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_0910
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lp_0910
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     lp_0910
   MMR (mismatch excision repair)
    Other MMR factors
     lp_0910
SSDB
Motif
Pfam: UvrD_C_2 AAA_19 UvrD-helicase Viral_helicase1 UvrD_C DUF2075 AAA_16 AAA_30 DEAD Catalase_C NACHT TMV_coat
Other DBs
NCBI-GeneID: 1061473
NCBI-ProteinID: YP_004888864
UniProt: F9UMB1
LinkDB
Structure
PDB: 
3DMN

Position
838125..840431
AA seq 768 aa
MAKSIKAAEQEHLDHVVAKIKVAEEQQSQTITRSEKDQADIKRDLLNNINIKTDSYEGMM
ETGLSVRQQQQMMDERQNSWKHATKQLSTLKKLEKNAYFARIDFHETGEPKPETIYIGLS
SFSDTPDHFLIYDWRAPISSIYYDGGLGHVTYQTPDGEQTVNVKLKRQLMVENGQIVTVY
DTDEAVGDSMLLEVLDEKSDVKMKSIVTTIQKEQNTIIRDTSSDLLFVQGAAGSGKTSSV
LQRVAYLLYRYRGNLTAGQVILFSPNQLFNDYINQVLPELGEQNMVQMTYFQYASYRLPH
MQVETLQQRFETENTPQMAKITKLEGSLAFFNAVTTYGRHLEQADMRFRNITLNDEVIIS
REKIKSIYYSFNENYHLANRLSATKEELIKILNRKVESEMRSKWVEEAVQDLSREEINQL
YGNQPREFKNGDKEFKFLARKIVMQRLGKARTQIVRNRFLSINMQYAHFLREVPKIIKLA
DHGISAADWDATVERKLAEIKERHISLTTVSAYMYLHDLMTGKHGQRDIRFVFLDEIQDY
NAFQLAFLKFSFPQARFTMLGDLNQAIFTKENSHSLINELATLFDPEKTRVVQLTKSYRS
TQQITDFTKEILVNGEAVTAFDRQGDLPNVVVTPNFEAGVDQVVDQLAMNDSERDTTAII
GKSLAECEALTKALKARGEQVTLIQTENQRLAPGVIVVPSFLAKGLEFDAVIVWNANQEN
YQREDERQLLYTICSRAMHELTLVAVGSLSPLLARVNHALYTLNEAKV
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggctaagtcaattaaagctgcagaacaggaacacttagatcatgtggttgcgaaaatt
aaggtggctgaagagcaacaaagccaaaccattacgcgctcggaaaaagatcaggccgat
attaaacgtgacttgctgaataacatcaatattaaaacggatagttacgaaggcatgatg
gagaccggattatccgtgcggcagcaacagcagatgatggatgagcggcagaatagttgg
aagcacgcgactaagcaattatcgacgttaaaaaagttggaaaagaatgcttattttgcg
cggatcgattttcatgagactggtgagcctaagcctgagacgatttatatcggactcagt
tcattttctgacacgccggatcactttttgatctacgactggcgagcgcctatttccagt
atttattatgacggtgggttagggcacgtgacgtaccagactccggatggtgaacagacc
gttaatgtgaagttgaagcggcagttgatggttgagaatggccagatcgtgacagtctac
gatactgatgaagccgttggtgactcgatgttactagaagtgttggatgaaaagtccgat
gtgaagatgaagagtatcgtgacgacgattcaaaaggaacaaaataccattattcgggat
acgagttctgacctcctgtttgtgcagggggcggccggttccgggaagacctcgtccgtt
ttacaacgggtcgcatacttgttgtatcgttaccggggtaatttgacggccggacaagtc
atcttgttctcaccaaatcaactctttaatgattatattaaccaagtattgcccgaactg
ggtgaacaaaacatggttcagatgacttatttccaatacgcatcgtaccggttaccacac
atgcaagttgaaactttacagcagcggtttgaaactgaaaatacaccgcagatggcaaag
attacgaagttggaaggtagcctcgcatttttcaacgcggttacaacgtatggccgacat
ttggaacaagcggacatgcgtttccgtaacattacgttgaacgatgaagtgattatttcc
cgggaaaagattaaatcgatttactactctttcaacgaaaactaccacttagcgaaccgg
ttatcagcaactaaggaagaattaatcaagattttgaatcgcaaggttgaatcggagatg
cgttccaagtgggtcgaagaagcggttcaagacttatcacgcgaagagatcaatcaatta
tatggcaatcagccgcgggaatttaagaatggcgataaagagtttaaattcttagcacgt
aaaattgtgatgcaacgcttaggaaaagcccggacgcaaatcgtgcgtaaccgtttcttg
agcatcaacatgcagtacgcgcatttcttacgcgaagtaccgaagatcatcaagttggct
gatcacggtatctcagctgctgactgggatgctacggttgaacggaaactagccgagatt
aaggaacgtcatatctcgttaacaacggtctcagcttacatgtacctgcatgacttaatg
accggaaagcacgggcagcgtgacatccggtttgtcttcttggatgaaattcaagattac
aatgcctttcagctagcgttcctgaagtttagcttccctcaagcccgtttcacaatgctt
ggtgacttgaaccaggcgatttttaccaaggaaaacagccattcgctgatcaatgaattg
gccacgttatttgaccctgaaaagacgcgggtcgtgcaattgactaaatcgtaccggtca
acacaacagattactgatttcaccaaggaaattttagtcaatggtgaagccgtcacggct
tttgatcgtcagggcgacttgccaaatgtcgttgtgacgcctaactttgaagcgggggtt
gatcaagtcgttgatcagctagcgatgaacgattctgaacgtgatacgacggcaattatc
gggaaatccttagcagaatgcgaggcgctcacgaaggccctgaaagctcgtggtgagcag
gtcacgttgattcaaactgaaaatcaacgcttggctcccggtgtcattgtagtcccgtct
ttcttagcaaaagggttggagtttgacgcggtcatcgtgtggaacgctaatcaggaaaat
taccaacgtgaagatgaacggcaactattatatacaatctgttcacgagccatgcacgag
ttaacgttagtcgcagtgggtagcttgtcaccgttactagcgcgggtgaaccacgccttg
tatacattaaatgaagcaaaagtttaa

DBGET integrated database retrieval system