KEGG   Lactobacillus plantarum WCFS1: lp_1085Help
Entry
lp_1085           CDS       T00115                                 

Gene name
aroA
Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase / chorismate mutase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01130  Biosynthesis of antibiotics
lpl01230  Biosynthesis of amino acids
Module
lpl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1085 (aroA)
Enzymes [BR:lpl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     lp_1085 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB IGPS
Motif
Other DBs
NCBI-GeneID: 1063382
NCBI-ProteinID: YP_004889004
UniProt: F9UMQ1
LinkDB All DBs
Position
987562..988557
Genome map
AA seq 331 aa AA seqDB search
MIIILKPATATAMQAKLVSQFGADHEIFTHNNRIAIQGLRPEALPADVQAASESILTAVP
AAVQSSRLFHPEDTIIKTPHSVIGGNQFVMMAGPCSVESAEHVDQMAAVAKQGGATIVRG
GAFKPRTSPYSFQGLGETGLQYLRTAADKHGLDMITEVMDDEHVAMVAKYTDIFQIGARN
MQNFSLLKAVGQTQIPVALKRGMSATIDDVLNAAEYIAAGGNHQIMLLERGIRTFDNKYT
RNTFDLGAVPVLQSLTHYPVIVDPSHAVGTWELVTPMAMAGVAAGASGMIVEIHDQPTQA
LSDGPQALKPATYLKMAQQAFQLHDLMQTWA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattattatattaaaaccagcaaccgctacggctatgcaggcaaagttagtgagtcaa
tttggtgcggatcacgagatcttcacgcacaataatcgaattgcaattcaaggattgcgt
ccagaagcacttcccgcggatgtgcaagcagccagtgaatcaatcttgacggcagttccc
gcagcggtccaaagcagccgtctctttcacccagaagatacgattattaagacgccacac
agtgtgattggcggtaatcaattcgtcatgatggctggcccgtgttcagtcgaaagcgct
gaacacgtggaccagatggccgcggttgccaagcagggtggtgcgacgattgttcgtggc
ggagcattcaagccacggacgtcaccttacagcttccaaggcctcggggagacgggactc
caatacttacggacggcggctgataaacatggccttgatatgattaccgaagtgatggat
gatgaacacgtggcgatggtggcgaaatacacggatatttttcaaattggtgcacgcaat
atgcaaaatttctcgttgcttaaagccgttggacagacccaaattccggttgcattaaag
cgaggaatgtcggcaacaatcgacgatgtgctcaatgcagctgaatacattgcagctggt
ggtaatcatcagatcatgcttttggagcggggaattcgaacgtttgataataagtacaca
cgcaacacgtttgacttaggtgcagtgccagtcttgcaatcgttgacacattacccagtc
atcgttgatccgagtcacgcggtcggtacctgggaactcgtgaccccgatggcgatggca
ggtgtagcagctggcgccagtggcatgatcgttgaaattcatgaccagccaacgcaagct
ttatccgatgggccgcaagcgttaaaacccgcgacgtacttaaaaatggcgcaacaggct
ttccagttacatgatctgatgcaaacgtgggcgtag

DBGET integrated database retrieval system