KEGG   Lactobacillus plantarum WCFS1: lp_1462
Entry
lp_1462           CDS       T00115                                 

Gene name
murC
Definition
(RefSeq) UDP-N-acetylmuramate-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00471  D-Glutamine and D-glutamate metabolism
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    lp_1462 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_1462 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_1462 (murC)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     lp_1462 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Amino acid ligase
   lp_1462 (murC)
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-GeneID: 1062363
NCBI-ProteinID: YP_004889306
UniProt: Q88WZ5
LinkDB
Position
1339441..1340751
AA seq 436 aa
MDKATVYYFVGIKGSGMSSLALILHDKGYQVEGSDIEQYTFTQKGLAAAGIKMLPFSEDN
IREGLTVIAGNSFTDDHPEIKKAREMGLPVYRYHEFLGKLMEGFTSIGVAGTHGKTSTTG
LLSHVLSHIAPTSYLIGDGTGKGTPDARFFVFEADEYRRHFVAYHPDYAIMTNVDFDHPD
YYKDLADVQSAFQQFGNQVKKGIFAWGDDESLRHLDVDTPIYYYGTNDRDDFQAVNIKRT
TKGSSFEVKYHDESLGKFEIPLFGEHNVLNSTAVIAVSYFEKVNLDEIRRELLDFSGVKR
RFSEHQVGDMVMIDDYAHHPSEIKATLDAARQKYPDKEILAVFQPHTFSRTKALMDGFAA
SLSKADHVFLTNIFSSAREKSGDVSSKDLAAKLPNGGEIITTDDMSALTAYHNAVAVFMG
AGDIQKYEKIYEDQMK
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggataaagcaacggtttattattttgttgggatcaagggctctgggatgagctcacta
gccttgattttacatgacaagggttaccaagttgaaggctcagatattgaacaatatacg
tttacgcaaaaaggtctagctgcagctggcattaagatgctaccgttttccgaagataac
attcgcgaaggcctcacagtgattgcggggaactcatttactgatgaccatcctgaaatc
aaaaaggcgcgtgaaatggggttgcccgtttatcgttatcatgaatttcttggaaaatta
atggaaggcttcacgagtattggtgtggccgggactcacgggaagacgtcgacaactggt
ttgttgtcccacgttttgagtcatatcgctcccaccagttacttgattggtgatgggacc
ggtaaaggcacccctgacgcgcgtttcttcgtttttgaagcggatgaatatcggcggcac
ttcgttgcttaccatcccgattatgccatcatgacgaacgttgactttgaccatcctgat
tactacaaggatttagctgacgttcaatccgctttccaacaatttggcaatcaagtgaag
aagggcatctttgcttggggtgacgatgaaagtttacgacacctcgatgttgatacccca
atttactattacgggacgaatgaccgtgacgactttcaagcggttaatatcaaacgaacg
actaaggggtcttcatttgaagtgaagtatcacgatgaatcgttagggaaatttgaaatc
ccattgtttggtgaacacaatgtcttaaacagcacggctgtcattgcggtttcttacttt
gaaaaggtgaacttggacgaaattcggcgggaactcctcgactttagtggggttaaacga
cgtttctcagaacatcaagttggcgatatggtcatgatcgacgactacgcacatcatcca
tcagaaattaaagcaacattggatgctgcacgccaaaagtatccggataaggaaatcttg
gccgtattccaaccacatacgttctcacggacgaaagcattgatggatggctttgcagcc
agcttaagcaaggcagatcacgtctttttgaccaatatcttcagttctgcccgtgaaaaa
tctggtgatgtttcctccaaagacttagctgctaagttacccaatggtggtgaaattatc
acgaccgatgacatgtctgctttaacggcttaccacaatgccgtcgctgtctttatgggt
gctggtgacattcaaaagtacgaaaaaatttatgaagaccaaatgaaataa

DBGET integrated database retrieval system