KEGG   Lactobacillus plantarum WCFS1: lp_1619
Entry
lp_1619           CDS       T00115                                 

Gene name
pkn1
Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lpl01001]
    lp_1619 (pkn1)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     lp_1619 (pkn1)
Protein kinases [BR:lpl01001]
 Serine/threonine kinases: Other
  Bacterial family
   lp_1619 (pkn1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PASTA APH Kinase-like Kdo RIO1 Seadorna_VP7 SfLAP Haspin_kinase Pkinase_fungal
Other DBs
NCBI-GeneID: 1063711
NCBI-ProteinID: YP_004889446
UniProt: F9UNZ3
LinkDB
Position
1473316..1475340
AA seq 674 aa
MTPNYTLSGRYRIVRSLGEGGMANVYLAHDLILDRDVAVKLLRLDLRDDPKTIKRFQREA
LATTELVHPHIVSLYDIGEENGMQYLVMEYVKGMDLKNYIKENFPLPLQQVIDIMEQILS
AVATAHAHNIIHRDLKPQNILIDEQGNAKITDFGIAVALSEHTMTQTNTILGSVHYLSPE
QARGSMATKQSDIYSLGIILYEMLTGSVPFKGETAVSIALKHFQNAMPSVREFDADIPQA
LENVVLQATTKDPRERYATVEDMAADLLTVLASNRAGEKRFVPQDVGNDETKIMPSADIQ
AAIAANQDGKTQVVAHKSKQPTLQRPAETTESQTDADEEPLPTRSWSKRHPLRRRLLFWG
GIILLLVVAVIVGLELSRPQMTTVPKVTGLSQRAATKVLKKHHLTVGTVQHAKSNQVAKN
QVIKSTPSVKTRVQERARINLVISNGAKVMSFGNYVNDNYHDVRQTLKSAGFKVKETYST
SSVAAGQIISQDVVAGSRVMPTDTTVTFTVSAGSRYVELKDLTGESKSDILDYAEANDLN
VNFKQGYSSEQKAGYSYDQDPDGGGNVRTGSTITVTMSRGSDNNVTTPQNFYVKLTVPYK
ALSATTAQANDVKIYLYDDTHMIETVYRDIAIMRSTKISLPFQLTGNTKGHYRIVRNGVT
IMEKKNITSKSATK
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgacacccaactatacccttagcggacgatatcggatcgttcggtccttaggtgaaggt
gggatggccaacgtttacttggcacatgacttaatattagatcgtgatgttgcggtcaaa
ctgctccggttagacttacgtgatgatcctaagaccatcaagcgattccaacgtgaggca
ctggcaacgacggaacttgttcacccccacattgtcagtttgtacgatattggcgaagaa
aatggcatgcaatacttggtcatggaatacgtcaaagggatggatcttaaaaattatatt
aaagagaactttccgttaccgttacagcaagtaatcgacatcatggagcagatattaagt
gccgtggcaacggcccacgcgcataatattattcatcgggatttaaaaccacaaaatatt
ttaattgatgagcagggcaatgctaaaatcactgatttcggcattgcggtcgcgttatct
gaacataccatgacgcagactaacacgattttaggttcggtccattatttgtcaccggaa
caggcccgcggtagcatggcgacaaaacaatcggatatctattcgttagggattatttta
tatgagatgttaacaggctcagttcctttcaagggtgagacggcagtttccattgcgtta
aagcattttcaaaatgcaatgccatccgtgcgagagtttgatgcggatattccgcaggca
cttgaaaacgtcgtcttgcaggcgacaacgaaagatccacgggaacgttatgctacggtc
gaggacatggccgctgacttattgacggtgcttgctagtaaccgtgcgggcgaaaagcgc
tttgtaccgcaagatgtcggtaatgatgagactaagatcatgcccagtgcggatattcaa
gcagcaattgcggccaatcaagacggtaagacccaggtcgtggcgcataaaagcaagcaa
ccaacactccagcgcccggctgaaacgactgagagtcagacagatgctgatgaagaaccg
ttaccaacacgttcttggtccaaacgacatccgttgcggcgtcggctcctcttttggggc
ggtattattttgttattagtcgtggccgtgatcgtcggtttggaattaagtcggccacag
atgacgacggtgccgaaagtaacgggcttaagtcagcgtgccgcaactaaggtcctcaaa
aaacaccatctcacggtcgggactgttcaacatgctaaaagtaatcaggtagccaaaaat
caggtgatcaaatcaacgcccagtgttaagacgcgggtccaagaacgtgctcgcattaat
ttggttatcagcaacggtgccaaggttatgagctttggtaattatgtcaatgataattac
catgatgttcgacagacgcttaaatcggcggggttcaaagttaaggaaacttacagtacg
tcgtcggttgcagcaggacaaatcatcagtcaggatgttgtcgctggtagtcgcgtgatg
ccgacagatacgacggtgacgtttacggtcagcgctggtagccgctacgtcgagctaaaa
gatttaactggtgagagcaagagcgatattctggactatgctgaggcaaatgatcttaat
gttaactttaagcagggctactcttcggaacagaaggcaggttattcctatgatcaagat
ccagatggcggtggcaatgtccggactgggtcgactattacggtgaccatgtcaaggggc
agtgataataacgtgacgacaccacagaatttttatgttaaactaacggtgccatacaaa
gcgttatcggccaccactgcccaggccaacgatgttaagatttatttgtatgatgatacc
catatgattgagaccgtttatcgcgatattgcaatcatgcggtcgactaagattagttta
ccgtttcagctgaccggtaatacgaaggggcattaccgaatcgtgcgtaacggggttacg
atcatggaaaagaagaatattacaagcaaaagtgcaacaaaataa

DBGET integrated database retrieval system