KEGG   Lactobacillus plantarum WCFS1: lp_2109
Entry
lp_2109           CDS       T00115                                 

Gene name
uvrC
Definition
(RefSeq) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    lp_2109 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_2109 (uvrC)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     lp_2109 (uvrC)
SSDB
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH_5 HHH_2 5_3_exonuc AbiGii_2 HHH Nop
Other DBs
NCBI-GeneID: 1063895
NCBI-ProteinID: YP_004889859
UniProt: Q88VE9
LinkDB
Position
complement(1903487..1905301)
AA seq 604 aa
MASAHIEHKLSLLPDLPGCYLMKNLNSQIIYVGKAKNLKNRVRSYFKSSHTGKTARLVSE
IADFEFIVTSTDKEAFLLEITLIQKHQPYFNIKLKKGTGYPYIKITNERDPQILIVSDVR
KDGGYYFGPYPNVYAAQETVNFIQKVYPLRRCHGFQKRPCLYYHMGQCLGACFKTVPVAE
YDAQIKRIKSFLNGHVETVKKQLTKRMDQAAADLEFERAAELRDQLNYIEMTVEKQKIIS
NDNTPRDLFNFYLDKGWLSIQVFFIRQARLMKREKRLFPVVSTAPEEMTSFILQFYNRKN
NVLPREVLVPNGLDKQVLSDILGIPVRTPQRGQKKDLLDMAQKNARIVLEEKFRLLELDE
RKTTGAMQEITDALGIPAGHKIEAFDHSHIQGADLVSAMVVFTDGQPNKKLYRKYKLRTV
DHADEAASTREVIRRRYTRLLKEHAALPDLILMDGGEIQLEAAKDVLENELGIATPVAAM
VKNDHHKTADLLASAGDQHLHLDPKSQGFYLLQRIQDEVHRFAITFHRQVHTKHSLSSRL
DEIPGVGPKTRNKLLRKFGSMSKIAGASLEEIQSLGIAKNVAQTVKFSLAGGGVTPKHYQ
KGAT
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggcatccgcgcatattgaacataagttatccttgttaccggacttaccaggatgttat
ctgatgaagaacttaaacagtcagatcatttatgtgggtaaggccaagaacttgaaaaat
cgggtgcgttcatatttcaaaagcagccatactggtaagaccgcgcggttagtatcagag
attgcggactttgagtttattgtgacctcaacggataaggaagccttcctgctagaaatt
acgttaattcaaaaacatcaaccgtactttaatattaaattaaaaaagggaaccggttat
ccatacattaagattaccaatgaacgagatccccagatcctgatcgtcagtgatgttcgt
aaagacggtggctactactttgggccatatcccaacgtttacgcggctcaggaaacggtc
aattttattcagaaggtctatccgttgcggcgttgccatggtttccagaagcggccgtgc
ctctattatcatatgggccaatgcttgggagcttgctttaaaacggtgccggtggcagaa
tatgacgctcagatcaagcggattaaatcctttttgaatggtcacgttgaaacggtcaag
aagcagttaactaaacgaatggatcaagcggccgctgacctagaatttgaacgagccgct
gaattacgtgatcaactgaattatattgaaatgacggttgaaaagcagaaaattatttca
aacgataatacgccccgcgacctgtttaatttctatcttgataaaggctggctttcgatt
caggtcttctttattcggcaagcgcggttgatgaagcgcgagaaacgcttgttcccagta
gtgtcaactgcacctgaagaaatgacgagctttatcttgcaattttataatcgcaaaaat
aacgttctaccacgcgaagttttagtccccaacggtcttgataagcaggtcctgagtgac
attctcggaattccggtaaggacccctcaacgcggccagaaaaaggatttgctggacatg
gcacaaaaaaatgctcgaatcgtcttagaagagaagttccggttgttggaattggatgag
cgcaagacgacgggggcgatgcaagaaatcacggatgctttaggcattcctgctggtcat
aaaattgaggcttttgaccactctcatattcagggggccgacttggtttctgccatggtc
gtcttcacggacgggcaaccgaataaaaaattgtatcggaaatataagttgcggacggtc
gatcatgctgatgaagctgcatcgacccgtgaagtgattcggcggcgctatacacggcta
ctgaaggagcatgcagcattgcccgacctgattttgatggatggtggcgagatccagctg
gaagccgctaaggacgtcttagagaacgaattagggattgcaacgccagtcgcggcaatg
gtcaaaaatgaccatcataagacggcggacctactcgcttctgctggtgatcagcatttg
catctagatccgaagagtcaaggattttatttattacaacggattcaagatgaagtgcac
cgctttgcgattacgtttcaccgacaagtccataccaaacattcattgagttcgcgcttg
gacgagatccccggggttgggccgaagacgcgtaataagttgttgcgtaaatttggatcg
atgagtaaaattgctggtgcctcactggaagagattcagtccctgggaattgctaaaaac
gttgcacaaactgtcaaattttcattagccggtggtggtgtaacaccgaagcattatcaa
aagggcgccacatag

DBGET integrated database retrieval system