KEGG   Lactobacillus plantarum WCFS1: lp_2196
Entry
lp_2196           CDS       T00115                                 

Gene name
murG
Definition
(RefSeq) UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
lpl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_2196 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lp_2196 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_2196 (murG)
Enzymes [BR:lpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     lp_2196 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Glycosyltransferase
   lp_2196 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C UDPGT Glyco_trans_4_4 Glyco_transf_4 CmcI
Other DBs
NCBI-GeneID: 1063553
NCBI-ProteinID: YP_004889929
UniProt: Q88V81
LinkDB
Position
complement(1982774..1983865)
AA seq 363 aa
MRLMISGGGTGGHIYPALALIDALKAHDPEAQVQFVGTHRGLESRIVPERGIDFKTIKIQ
GFKRSLSLQNVKTVYLFLKSVVTARKYIKAFKPDVVVGTGGYVSGAVVFAASQMHIPTVI
HEQNSVVGVTNKFLSRFVDKIAISFESARSQFPAQKVVMTGNPRAQQVANIKKSGALAQF
DLDPDIPTALIFGGSRGAARINAAAVAAIPELNKRDYQTLFVTGQVHYEKIRNGLSATAL
APNVKIEPYIKNMPAILPEVAVILGRAGATSIAEITALGIPSILVPSPYVTNDHQTKNAQ
SLVNAGAAELIKEADLTGTSLVAALDGLLQSTTHRETMAANAKKLGMPDAADQLLHVLET
VIK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcgattaatgatttctggcggcgggacaggtggtcatatctatcccgcactggcactg
atcgatgccttaaaagcacatgatcccgaagcgcaagttcagtttgtgggaacccatcgt
ggactagagagccgcattgtgccggaacgggggatcgattttaaaacaatcaagatccag
ggctttaagcgttcattgtcattacaaaatgttaaaacagtctatttatttttaaagagc
gtggttacggcgcgtaagtacattaaggcgtttaaacctgatgttgtggtcggaaccggg
ggctacgtgagtggtgcggtcgttttcgcggcgagccagatgcacattccaacggtcatt
catgaacagaattcagttgttggtgtcactaacaaattcctaagtcggtttgtggataaa
atcgccatttcatttgagagtgcgcgatcacaatttcccgctcaaaaagttgtgatgact
gggaatcctcgagcccaacaagtggctaatattaaaaaaagtggcgctttggcgcagttt
gatctggatcctgacattccaacggcgttgatttttggggggagccggggtgctgcgcgc
attaacgcagcagcggtcgcggcaattcctgaactgaacaaacgtgactatcagaccttg
ttcgtcaccggccaggtacactacgaaaagattcggaatggcttgtcagcgacagcgcta
gctccgaatgttaaaatcgaaccatacatcaaaaatatgccagcaattctaccagaagtc
gcggttattcttggtcgagcaggtgcaactagtattgcggaaattacggctttagggatt
ccttcaattctagttcctagtccatacgttacgaatgatcatcagaccaagaatgcacaa
agcctcgtgaatgcgggggcggctgaactgattaaggaagctgatttgacgggaaccagt
ttggtagctgcattagatggccttctccaaagtaccacgcatcgtgaaacgatggcggct
aatgcgaaaaaactggggatgcctgatgcggccgaccagttactacacgttttagaaacg
gtgattaagtag

DBGET integrated database retrieval system