KEGG   Lactobacillus plantarum WCFS1: lp_2915
Entry
lp_2915           CDS       T00115                                 

Gene name
uvrA3
Definition
(RefSeq) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    lp_2915 (uvrA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_2915 (uvrA3)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     lp_2915 (uvrA3)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      lp_2915 (uvrA3)
SSDB
Motif
Pfam: ABC_tran UvrA_DNA-bind AAA_29 SMC_N AAA_21 AAA_15 DnaJ_CXXCXGXG AAA_16 HypA AAA_25 RsgA_GTPase ATPase AAA_23 DUF463 NACHT DZR Anti-TRAP End_N_terminal DUF5351
Other DBs
NCBI-GeneID: 1063311
NCBI-ProteinID: YP_004890506
UniProt: F9US03
LinkDB
Position
2591590..2594097
AA seq 835 aa
MPQTTLPTHIQVRGAHVNNLKNIDIDIPLNEFVAITGRSGSGKSSLAMGVLYAEGARRYL
NALSTFTRRRINQVGKASVDSVQYLPSALALRQRPQVPGVRSTVGTMSESLNILRLAFSR
LSSAVCPNGHRMPPTLDVAENDGYVTCPTCGAKFRAPGAEDFAFNSGGACPTCGGLGQVR
QIDPALIIADENQTIEEGAVASWHLPGRNFMPIVAREIGIPIDIPYKDLSEADKTRVLHG
PKQTVAINIPSAKGKIFHMDNAVYENAFAAVEDSMATTKNERAINRLNRFYKFDTCPDCH
GSRFNPQLFNYELNGQNIATVSDMTVAALHDFATTIVPWLPTKMHHLGQSLVDELLLSLQ
PMEELGLDYLTLSRPGATLSTGELQRIQLGRTLRSATTGVLYVLDEPSVGLHPANVAGLI
KAFRGLVAQGNSVVVVDHDTSIISAADDVIEIGPGAGKHGGTVVGQGTVAAIKRDKKSLI
APFLTGTATLRERPVLTDDALWKKGALAIEVAHHFNIQDITARIPKNRFTTVTGMSGAGK
TTLVLDSLIPALIATAKKRPLPTHVKAFDNGHIRHVVTVDSVPVGKNVRSTVATYTNILD
HLRQLFAATPAAQANSWTASQFSYNVAAGACPTCGGTGQISLDVQYLPDITEVCPQCHGK
RYNKQTLTVKWHGYSIADILDLAVDEALPIFKVQSAIANTLQILHDMGLGYLLLGESTPA
LSGGEAQRLKLTSRIGKRQTGTLFVFDEPSVGLHPLDIQQLVKVFDQLIQQGATVIAIEH
DLDVIANADYVIDMGPAGGINGGNIVATGTPLAVSQNPTSVTGQYLKTHLALFHV
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgccacaaaccacgttaccgactcacattcaagtgcgaggcgcacacgtcaataattta
aaaaatatcgatatcgacattccactcaacgaatttgttgcgattactggtcgcagtggg
tccggtaagtcatcactcgcaatgggcgtcctgtacgctgagggggcccgccgctactta
aacgccctgtcaacctttacccgccgccgaatcaatcaggtcggcaaagccagtgttgat
tcagtacaatacttaccatctgcattagcgctacgccaacgcccccaggttcccggcgtc
cgttcaaccgtcggcaccatgtctgaaagcttaaatatcttaaggctagccttctcacga
ctcagctcagcagtttgccccaatggtcaccgcatgccaccaacgctcgatgtggctgaa
aatgatggttacgtcacctgtccgacttgtggcgccaaattcagagcgcccggcgccgaa
gatttcgccttcaattcaggtggggcctgtccgacttgcggtggcctaggccaagttcgc
caaattgacccggcactcattattgctgatgaaaatcaaactatcgaagaaggggccgtt
gcttcttggcacctgcctggacgtaactttatgccgatcgttgcacgcgaaattgggatt
cccatcgatattccgtataaagaccttagtgaagccgataaaacacgcgtattgcatggt
cctaagcaaaccgttgccatcaacattccaagcgctaaaggtaaaatctttcacatggac
aacgctgtctacgagaacgcctttgccgccgttgaagatagtatggcgacgaccaaaaat
gaacgggcaattaatcggctgaatcgcttttacaagtttgatacttgcccagattgtcac
ggatcacgcttcaatcctcagttgtttaactacgaattaaatggtcaaaacattgcgacg
gttagtgatatgactgtcgccgccttgcatgattttgcgaccacgattgtcccgtggcta
cctactaagatgcatcatcttggacaatcccttgttgatgaattgctactcagcctgcaa
cccatggaagaacttggactcgactacctcacactcagtcgtcccggtgcgaccctgtca
actggtgaattacaacgcattcagctcggacgcactctgcgtagcgccacgactggcgtg
ttatatgtccttgatgaaccttccgttggacttcatccagctaacgtggcgggcctaatc
aaagctttccgcgggctagtcgcccaaggaaattccgtcgtggtggttgaccacgacact
agtattatcagtgcagctgatgatgttattgagattggtccgggggctggtaagcacggc
ggtaccgttgtcggacaaggcactgtcgcagccatcaagcgggacaaaaagtccttaatt
gcgccatttctcaccggtactgccactctgcgtgaacgccccgtattaaccgacgatgcg
ctctggaaaaagggggcccttgctattgaggtggctcatcactttaacatccaagacatt
acggcgcgcattcccaaaaaccgtttcacgaccgtcacgggtatgagcggcgctggtaaa
acgactctggtactagatagtttgattccagcactgattgccacagctaaaaagcgacca
cttccaacccacgttaaggcctttgacaatggtcacattcggcacgttgttaccgtcgac
tcagtgcccgttggtaagaatgtacggtcaacggtcgccacttataccaacattctcgac
catctacgccaattattcgccgctaccccagcagcacaagcaaacagttggaccgctagc
caattttcatataacgtcgctgcgggtgcttgcccaacttgtggtggtacgggccaaatc
tctttagatgtgcaatacttgccagacattaccgaagtctgcccccaatgccacggcaag
cgctacaataaacagacgctgactgtcaaatggcatggctattcgattgcggatatttta
gatcttgcggttgacgaggccctaccaattttcaaagtgcaatccgccatcgctaataca
ctccagatcctgcatgatatgggactaggctacttactattaggtgaaagtacgccggca
ctctcgggtggcgaagctcagcgcctgaagctcacctcccgcattggcaaacgccaaacg
ggaacgctctttgtcttcgatgagccttcagtcggtttgcacccgctcgacattcagcaa
ctcgtcaaagtctttgaccaactgattcagcaaggggcaaccgtcattgccatcgaacac
gatctcgacgtaatcgccaacgctgattacgttatcgatatgggacccgcgggcggtatc
aacggtggtaacattgtcgccaccggtaccccattggccgttagtcaaaatccaactagt
gtaacagggcaatatttgaagacgcatttggccctattccacgtttaa

DBGET integrated database retrieval system