KEGG   Lactobacillus plantarum WCFS1: lp_3189
Entry
lp_3189           CDS       T00115                                 

Gene name
dacA1
Definition
(RefSeq) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_3189 (dacA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lpl01002]
    lp_3189 (dacA1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_3189 (dacA1)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     lp_3189 (dacA1)
Peptidases and inhibitors [BR:lpl01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   lp_3189 (dacA1)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   lp_3189 (dacA1)
SSDB
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase PBP5_C UPF0180
Other DBs
NCBI-GeneID: 1061957
NCBI-ProteinID: YP_004890730
UniProt: F9UT98
LinkDB
Position
complement(2841541..2842875)
AA seq 444 aa
MRFAGKLKKVMIALVAAVTFSTAGLGIAGADLQAQAASTPSISAKAAIAVDASTGQILYD
KNSSKPMAIASMTKMLSTYLVLKAIHEGKLSWNQKISVSKAVAKMSQNTEYANVPLLSTK
TYSVRQLYNATEIYSANAAITALGDAVAGTPHKFVSLMRKTAKSWGITDATIINASGLTN
KEVGSTIGYSNVAASAENEMSAQDVATVAQKLLSDYPEVLKTSSIAHAWFEKGTSSATKM
DNRNYMLKGLVKHYSALPVDGLKTGTSTKAGNAFTGTVKFSNGNRIITVVMHAGAANDSG
TERFTQTAEIMSYVYHNYTTTTINKNGKINGVKAVDVQDGKSLTSQLVSNSGATKIYLPT
GTDASAVTGKVSLKKSATTDGKLQAPVKNGKTVGTVNLNLSKKAIKVVDGTTSKNMTINV
TPKKSIDKANIFVRMWRGVKSWFN
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagatttgcgggaaagttaaagaaagttatgattgccctcgttgcggcagtcacgttt
agtacagctggtttaggcattgcgggggctgacctccaggcccaagcagccagtacacca
tcgatctctgcgaaagccgccattgcggttgacgcgtcgaccggtcagatcctgtatgat
aagaacagtagtaagccaatggcgatcgcatcaatgacgaagatgttaagtacatattta
gtgcttaaggcgatccatgaaggtaagttgtcttggaatcaaaaaatcagtgttagcaag
gcagtcgctaagatgagccaaaacacggaatatgcgaacgtaccgttattatcaacgaag
acgtattcagtgcggcaattatataacgcgactgaaatctattccgctaacgccgctatc
acagccttgggtgacgcggtagccgggacgccccataagtttgttagcttgatgcggaag
acggctaaatcatgggggatcacggacgctaccattattaatgccagtggattaaccaat
aaagaggttggcagcacaattgggtacagtaacgttgccgccagtgctgaaaacgaaatg
tcagcacaagatgttgctaccgttgcgcaaaagctattatcagattacccagaagtttta
aagacttctagcattgcccatgcttggtttgaaaagggcactagttcagcaaccaagatg
gataaccgaaactacatgctcaaaggattagttaaacattactccgcacttcctgtggat
ggtttgaagactgggacttccactaaggctgggaatgccttcactgggaccgttaagttt
agcaatggtaaccggatcattacggtcgtcatgcatgccggtgccgctaacgatagtggg
acggaacgtttcactcaaacggctgaaatcatgtcatatgtttaccacaactacacgact
acgacgattaacaagaatggcaagatcaatggtgtgaaagccgttgatgtccaagatggg
aagtccttaacgtcgcaactcgtttcaaatagtggtgcaaccaagatttacttgccaacc
gggacggatgctagtgccgttactggtaaggtcagcttgaagaagtcggcgacaaccgat
ggtaaattacaagcacccgttaagaatggcaagactgtcggtactgttaacttgaaccta
agcaagaaagctatcaaggtagttgacggaacgactagcaagaatatgaccatcaatgta
acgcctaagaagtccatcgacaaagcaaatatctttgtacggatgtggcgcggggttaag
agctggttcaactaa

DBGET integrated database retrieval system