KEGG   Lactobacillus plantarum WCFS1: lp_3407
Entry
lp_3407           CDS       T00115                                 

Gene name
uppP
Definition
(RefSeq) undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_3407 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_3407 (uppP)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     lp_3407 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Diphosphatase
   lp_3407 (uppP)
SSDB
Motif
Pfam: BacA DUF4407 DUF4418
Other DBs
NCBI-GeneID: 1063763
NCBI-ProteinID: YP_004890902
UniProt: Q88SK7
LinkDB
Position
complement(3021087..3021914)
AA seq 275 aa
MLDIFKAVILGIVEGITEFLPISSTGHLVLVDEFIKMQQSTQFTDMFNVVIQLGAIMAVV
VLYFHKLNPLSPRKDTTEKRNTWVLWSKVLLAVIPSVIVGLPLNDWMDEHLMNWAVVSAT
LIIYGVLFIVIENHNKRLTPRFANLQTLPYTTALFIGCFQLLSLIPGTSRSGATILGAIL
IGTSRYVATEFSFFMAIPTMFGASLLKLVKFFAHGGSLAGLQGAVLAVGVIVSFVVAYLS
IRFLLDYIKKNDFKAFGWYRIVLGVLVIGYFTLIH
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgttagatatttttaaagcggtaatcttggggattgttgaagggattactgaattctta
ccaattagttcaacggggcatttagtcctagttgacgaatttatcaagatgcaacagtcc
acgcagtttacggatatgttcaacgttgtgattcaattaggggcgatcatggcggtcgtt
gtcctgtatttccataaactaaatccgttgtcaccacgcaaggataccacggaaaagcga
aatacttgggttctctggagtaaggtgttattagcggtcattccatcagtgatcgtgggg
ctaccgttaaatgattggatggacgaacatttaatgaattgggcggtcgtttctgccacg
ttgattatttatggggtcctattcattgtgattgaaaatcataataagcgcttaacaccc
cgcttcgctaatctacaaacgttaccttatacgacggcattgttcattgggtgcttccag
ttgctctcgttgattccagggacttcacgttccggtgcaaccattttaggggctatcttg
attggaacttcacgctacgtcgcaactgagttttcattcttcatggcaattccaacaatg
tttggggcgtcattattgaagcttgtgaaattctttgctcacggtggttctttagctggt
ttgcaaggagcagtcttagccgttggggtgatcgtgtccttcgtagtcgcttacttgtcg
attcgtttcttgttggattacatcaagaaaaacgacttcaaggcgttcggttggtaccga
attgtcctgggggtacttgtgattggctactttacgttgattcattaa

DBGET integrated database retrieval system