KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0027Help
Entry
LP6_0027          CDS       T02689                                 

Gene name
potE1
Definition
(GenBank) basic amino acid/polyamine antiporter, APA family
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Brite
KEGG Orthology (KO) [BR:lpm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LP6_0027 (potE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C UBZ_FAAP20 TMEM18 DUF5592
Motif
Other DBs
NCBI-ProteinID: AGN12953
LinkDB All DBs
Position
31774..33165
Genome map
AA seq 463 aa AA seqDB search
MDLFRKKDIKGSLDNESHLAKCLSVFDLTFLGVGAIIGAGIFVLTGIVAATISGPAVIFS
YVVAGFACAFAALSYAELAASIGGCGSAYGYAYAGFGELIAWIVGWDLLLEYSIAVSAVS
IGWSGYANDFLMALKIFIPTHLLHGPADGGDLNILAILIIAVLTTLLIVGVKSSSRFNNI
MVLVKLLVIFIFIAIAFGEVKVENWSSFMPYGWAGVMKGASIIFFAYVGFDAVSTAAEEA
INPQRDLPIGIIASLAICTVIYILVSGLLTGIAHYTTLNVSSPISHVLLVLGYKTAAGLV
GVGAIAGLTTVMLVLFYGLTRVFLAMSRDGLLPRFLSKTNEHTKTPIRIILLCGILMASL
ASVTPIGTLAELVNIGTLFAFIVVCGGVLYLRRTHPDMERPFKTPFMPYVPILGIISCFY
LILNLPWVTILRFIIWMAVGMAVYFAFSRGNSALSVEGDCAAE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtttcgtaaaaaagatataaaagggtcgctagacaatgaatcacatttagct
aaatgccttagtgtttttgaccttacctttttgggagtgggcgcgattataggtgctggt
attttcgttcttacaggaatagtagctgccactataagcggaccagccgtgatattctcc
tatgttgttgccggatttgcctgcgcctttgccgccttatcctatgctgaactggctgcc
agcatagggggttgtggcagtgcttatggatatgcttacgcaggttttggtgagttaatc
gcgtggatcgtcggatgggatttgttattggaatattctattgctgtatcggctgtttcc
atcggctggagtggttatgccaatgattttttaatggctctgaaaatatttattccaact
catttattacatggtcccgctgacggtggggatctcaatattttagccattttgatcata
gctgttttaactacattattaattgttggtgtgaaatccagttctcgatttaataatatc
atggtgcttgttaagcttttggttatttttattttcatagctatcgcatttggtgaagtg
aaggttgaaaattggtcttctttcatgccctatggttgggctggtgttatgaaaggtgct
tcaatcatcttttttgcctacgtggggtttgatgctgtttctactgctgctgaagaagca
attaatcctcaacgagacttacccatagggataatcgcttctctggctatttgtacagtg
atctatattctggtttcaggtttattaacagggattgctcattacactacccttaacgtt
tcatcaccaatcagtcatgtcctgcttgtcttgggttataaaacagcagccggactggtc
ggtgtaggcgcaattgctggtttaaccacagttatgttagttctgttctatggattaacc
agagtatttttagcaatgtcaagggatggcttattgccaaggttcttatcaaaaacgaac
gaacacactaaaacaccaattcgaattatattgctatgtggcatattaatggcatctctc
gcctcagtaactcctattggtactctagcggagctagttaatattggcaccttgtttgcc
tttattgttgtttgtggaggtgttttatatttaaggcgaactcatcctgatatggaaaga
ccatttaaaactccatttatgccttatgttcctatactaggcataataagctgtttttat
ttaattttaaatttgccatgggtaacgatattgcgttttataatttggatggcggtaggt
atggctgtctattttgcatttagcaggggaaatagtgctttgagtgttgagggggattgt
gccgccgagtga

DBGET integrated database retrieval system