KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0144Help
Entry
LP6_0144          CDS       T02689                                 

Gene name
tktA
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00030  Pentose phosphate pathway
lpm01100  Metabolic pathways
lpm01110  Biosynthesis of secondary metabolites
lpm01120  Microbial metabolism in diverse environments
lpm01130  Biosynthesis of antibiotics
lpm01200  Carbon metabolism
lpm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LP6_0144 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    LP6_0144 (tktA)
Enzymes [BR:lpm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     LP6_0144 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: AGN13069
LinkDB All DBs
Position
complement(167051..169129)
Genome map
AA seq 692 aa AA seqDB search
MNGLLADLCLLSDNSASVKCKRVGMNSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADI
ATVLWKKFLKFNPKNPHWFNRDRFVLSNGHGSMLLYSLLHLTGYNLDISELKNFRQLHSK
TPGHPEHGHTPGVETTTGPLGQGLANSVGMALAERVLASTFNHDHFNLVDHYTYTFAGDG
CLMEGISHEACSLAGTLGLGKLIVFYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPI
DGHDADQIEQAISAARENTTQPSLIICKTVIGLGSSVAGSEKAHGSPLSAQDINNVREFF
NWKHAPFEIPDSIYKQWDHREQGEKEEQQWLQLLHEYRQQHPSEHDEFLRRANGDLPDDW
QEISAGFLKQCLNNEKAIATRKASQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAIT
AHNFSGNYLYYGVREFAMAAIMNGLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVI
YVLTHDSIGLGEDGPTHQPIEHIAMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSAL
LLSRQNLPALAHGTDAADLIKKGGYIIADCEGKPDAILIATGSEVQLAITAAEKAKARGL
QVRVVSMPCAERFLAQSDDYKNQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCFG
VSAPATDAFNYLGITVEKIINTLDTLTKQTMV
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtcttcttgccgatttatgccttctgagcgacaatagtgcctcagttaaatgc
aaaagagtaggcatgaacagttttacagaattagctaatgcagtacgcatgttaagcatc
gatgcagtaaaccaagctcaatcaggccaccctggcatgcccttgggtatggctgatatt
gccaccgttttatggaaaaaatttctaaaattcaaccccaaaaacccgcactggtttaac
agagaccgttttgtattatctaatggccatggttccatgcttctctattctttactgcat
ttgaccggatacaacttggatattagcgagcttaaaaacttccgccaattgcactcaaaa
acaccagggcatccggaacatgggcacactcctggtgtcgaaacaacaacagggccatta
ggtcagggtttagccaattcagtcgggatggccttagcggagcgtgtgctggctagtacc
tttaaccacgatcactttaacctggttgatcattatacatatacttttgccggtgatggt
tgcctgatggaaggcatttctcatgaggcgtgttctttagctggcactcttggtttggga
aagctcattgtattttatgacgacaatgggatatctattgatggtaaggtagaatcctgg
tttacggacgatactacgtctcgctttaaagcctacaactggcaagtcataggccccatc
gatggccacgacgcagatcaaattgagcaagccatatcagcagcacgcgagaacacgact
caaccttcattaattatctgtaaaaccgtcataggactgggctcctctgtagccggtagc
gaaaaagcgcacggctctccattgagtgcccaagacataaataatgtccgtgaatttttt
aattggaaacatgctccctttgaaattccagattcgatatacaagcaatgggatcataga
gagcaaggagaaaaagaagagcaacaatggctgcagctcctgcatgaataccggcaacaa
catccatcggaacacgatgagtttttgcgtcgtgccaatggcgacctgcccgatgattgg
caagaaatatcggctggattcctaaaacaatgcctgaacaatgagaaagccatagcaacg
cgtaaggcgtcgcagcaatgcatagagtttttcgcgccaatattaccggaaatgtttggc
ggctcagcggatttgactggttccaataataccgactggtcaggcagcaaagccatcacg
gcccataatttttccggaaattacctttattatggagtgagggaatttgccatggcagcc
atcatgaatggacttgctgtgcatgggggattcattccctacggcggaacattccttgtt
ttcgcagattatgcaagaaatgccatccgtttaagcgctttaatgaaacaaagagtgata
tacgtattgactcatgattctatcggtttaggggaagatggcccgacacaccaacctata
gaacatatcgctatgttaagaatgacccctggcatgacggtctggcgccctgctgatttg
atggaaaccgctgttgcatggcaacaatcgttagaacatcataatggcccgtctgcctta
ttactctcaagacaaaatctgcccgctttagcccatggcaccgatgcggctgacttgatt
aagaaaggcggatatattattgccgattgtgaagggaaacctgatgctatcctgatagcc
actggttcagaagttcaactggctataaccgcagcagaaaaggcaaaagcaagaggtctc
caggtcagggtggtatccatgccctgtgctgagcgattccttgcccagagtgatgattac
aaaaaccaggtattacctggtcaggttcgcacacgtattgcgatagaagcagctagcagt
gcctattggcaccaatttgttggctttgacggcgctgtcattgggctggattgttttggg
gtatcagctcctgctacagatgcttttaattaccttggaattacagtagaaaaaattatc
aatactctagatacattaaccaaacaaacaatggtgtaa

DBGET integrated database retrieval system