KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0982
Entry
LP6_0982          CDS       T02689                                 

Definition
(GenBank) hypothetical protein
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
SSDB
Motif
Pfam: DUF2976 Colicin_V
Other DBs
NCBI-ProteinID: AGN13896
LinkDB
Position
complement(1095122..1095487)
AA seq 121 aa
MKTTLRTLYLGAVNLFYAPVLLADNWFPKISDADNIGDGSKSMMSVTGNYVKQGLGLLLF
ITAVVTFIKFITTVQHGIEESKKNEGSMVAFGTFAVMGITYLAISIASGYVGYTMITKFK
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaacaacgcttcgcacgctctacctgggagctgtcaatcttttttacgcccctgtg
ttattggcagataactggttccctaaaatttctgatgcggacaacattggtgacggttcc
aaaagcatgatgtcggtaacaggcaattacgtcaaacagggtcttggcttattgctgttc
attaccgcagtcgtgacctttatcaagttcattaccacggtgcaacacggtattgaagaa
tccaaaaagaacgaaggttccatggtggccttcggtacttttgccgtaatgggaatcacc
tatttagccattagcatcgcttctggttatgtgggttataccatgattaccaagttcaaa
atatag

DBGET integrated database retrieval system