KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_1356Help
Entry
LP6_1356          CDS       T02689                                 

Gene name
pbpA
Definition
(GenBank) penicillin binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00550  Peptidoglycan biosynthesis
lpm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LP6_1356 (pbpA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LP6_1356 (pbpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpm01011]
    LP6_1356 (pbpA)
Enzymes [BR:lpm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LP6_1356 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:lpm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LP6_1356 (pbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGN14266
LinkDB All DBs
Position
complement(1527219..1529072)
Genome map
AA seq 617 aa AA seqDB search
MYRNQSFKNYRAESQHQRFRLNLLIAILIILSLILILRLAFLQISEFKRYQTLSLKNQMS
VIPIAPPRGVILDRNGVLLAENIPVYVLEITPERVKDMKQTLTKLRELIPSITDEDIDSF
NKTRLQNRSFVPIPIKLKLSQEEVATFASNQYHFPGVSIKARLMRHYPLGEITAHALGYV
GRINIQELKQVDSTNYRATNFIGKAGIEKYYEDILHGKVGYQMVETDVSGRTLRIINKVN
PHSGAKLYLSIDARLQEAAYNALKDKRGAVVVINSRNGEVLAMVSSPSFDPNIFVSGVSK
ADYKVLSNALQRPLFNRAVRGVYPPASTIKPFVGLAGLDKGFITTTTEIYDPGKYKLPTS
SHVYRDWKKTGHGVINFKRAITVSCDTFFYQLGNKMGISNIEDMLVKFGLGQLTHVDLHE
EANGVIPSARWKRQTKGVSWYPGDTLISAIGQGFMLATPLQMANATASLSQHGQRFRPHL
LIKTVNSDTNEMEEYKPFEEYPVSLRDEANWDVVIDAMHSVLTSNEGTGYRFGRNPPYPV
AGKTGTAQVYSGRQYEKAKYEDIPEHLRDNSLFIAFTPVEKPEIAIAVVVENDTIASTVA
RKVLDTYYQLYPIKKTP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggaatcaatcatttaaaaactatcgtgctgaatcccaacatcaacgatttaga
cttaatctgttaattgcgattctgattattttatctttaatactgattttaagattggcc
ttcctgcaaatatccgaatttaaacggtatcagaccttatctttaaaaaatcaaatgagc
gtaatacctattgctcctccaagaggggttattttggatagaaatggagtattactcgct
gaaaacataccagtgtatgtgctggaaatcactcccgaacgtgttaaagacatgaaacag
actttgactaaacttcgagagttaattccttcaattacagacgaagatattgatagcttc
aataagaccagattacaaaatcgttcttttgttcccattcctatcaaattaaaattaagc
caggaagaagtagctacctttgccagcaatcagtatcatttcccgggagtaagcattaaa
gcgagattgatgcgtcattaccctcttggagagattactgcccacgccttggggtatgtt
ggtcgtattaatattcaggaactaaaacaagtggactccactaattatcgtgctaccaac
tttattggcaaggccggtattgaaaaatactatgaagatattctccatggtaaagtgggt
tatcaaatggtagaaactgatgttagtggccgcactttaagaataataaataaagtcaat
cctcattcaggagcgaaactgtatttaagcatagacgccagacttcaggaagcagcttat
aatgcattgaaggataaacgaggtgcggtagtagtcataaactctcggaatggcgaagta
cttgcgatggtgagttctccaagttttgatcccaatattttcgtcagtggagtcagtaaa
gcggattataaagtgttatccaatgccctccagcgccctctttttaatcgagcagttcga
ggcgtttacccccctgcatcaacaatcaaaccgtttgttggactggctggtttggataaa
ggcttcattaccacgaccactgaaatatatgaccccggtaagtacaaactccctacttcc
agccatgtttaccgtgattggaaaaaaacaggccacggggtcattaatttcaaacgagcc
attaccgtctcttgtgacacttttttttaccaactaggtaataaaatgggaatctctaac
attgaggacatgcttgtaaaatttggcttgggacaactaacacacgttgaccttcatgaa
gaagcaaatggagtaatacctagcgctcgctggaaaagacaaactaaaggagtatcctgg
tatcctggagatactctcatttctgcaataggacaaggatttatgctggcaacccctttg
caaatggctaatgccacagcttccctaagccagcatggacaacgattcagacctcaccta
ctgataaaaacagtaaacagcgataccaatgaaatggaagaatacaagccttttgaagaa
tacccagtttccctgagagatgaagcaaactgggatgttgtgattgatgcgatgcatagc
gtactaaccagcaatgaaggaacaggttaccgttttggcagaaatcctccttacccggta
gcaggaaaaacaggtacagcacaagtatacagcggaagacaatatgaaaaggcaaagtac
gaagacatacctgagcatttgagggataattctttatttattgcatttactccagtagaa
aaaccggaaattgccattgcggtggtagttgaaaatgatactatcgcttccactgtagca
cgtaaggtacttgacacttattatcaactttatcctattaagaaaacaccatga

DBGET integrated database retrieval system