KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_1451Help
Entry
LP6_1451          CDS       T02689                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LP6_1451
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lpm01002]
    LP6_1451
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpm01011]
    LP6_1451
Enzymes [BR:lpm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LP6_1451
   3.4.21  Serine endopeptidases
    3.4.21.-  
     LP6_1451
Peptidases [BR:lpm01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   LP6_1451
Peptidoglycan biosynthesis and degradation proteins [BR:lpm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LP6_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AGN14361
LinkDB All DBs
Position
1628540..1630201
Genome map
AA seq 553 aa AA seqDB search
MEMRMMKRYSKRLLTYIYLLMKSIPLVFTMQQLSYSTDKIPIPTNKLPDDLNKVMNKSIY
KKALWGLRVVDLDTGNVLLNLNSSTQFYIGSVRKIFSVGELLNERGADYQSVTRVHYDGV
VHNGNLNGNLVLVASGDLTMGGRTLPDGHVAITEYDHNEANSLGNAIITQTNLLAGYQYL
AKQVYKAGIRSISGDIVIDDRLFEPFNFRGEFDVTPIFINDDVVDIVILPSLINENANVS
WLPHSSAFTVINQLLTVNPHEKYNLELESKLPACIGKPGCSGIIKGHLPINFIPPLTHNY
PLVQTFRITKPSNYARTIFIEALQEAGINVSSIDKTKENPKKLLKSTNLYNKNNKIAALK
SLPLGEHVKYILKVSYNIGADTSLVLYGLTKGARSMIESLNVEKKILDKKYGISPSEYHF
IDGSGGGETKATNTAIIKWLTIMSKRPVFNIFYNSLPILAVDGSLGSINNFQSDPSLSGA
TGRVHAKTGTYVLGNESGMLVKGRSLAGYIISKKNHRLAFALVVNNIPIQSLEDLFAVAQ
DQGIIASILWRDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcgaatgatgaagagatactcgaaaagattactgacttatatttatttactt
atgaaaagcatacctctagtgttcacgatgcaacaactatcatatagcacagataaaatc
cctataccaaccaataaactacctgatgacctaaacaaagtgatgaataaatctatttat
aaaaaagcgttgtggggattacgtgttgttgatcttgatactggtaatgtattgctgaat
ctcaactcaagtacgcagttttatattggttctgtgcgcaagatatttagtgtaggcgaa
ctattgaatgaaagaggagctgattatcaatctgttactagagtccattatgatggtgta
gtacacaatggtaatctgaatgggaatctggtactcgttgcttcaggtgatttgaccatg
ggaggacgaactttacctgatggacatgtcgctatcactgaatacgatcataacgaggca
aattcattgggtaatgcaattattacacagactaatcttttagcaggttatcaatatctc
gctaaacaagtttacaaagctggcattcgctctatttcaggcgacattgtgatagacgat
agattgtttgaaccatttaatttcaggggtgaatttgatgtaacacctattttcataaac
gatgatgtagttgatattgtaattcttccaagtttgataaacgagaatgcaaatgtatcg
tggctgccacattcatcggcgttcaccgttatcaaccaacttcttacagttaatccgcat
gaaaaatataatcttgaacttgagtcaaaattacctgcctgcataggtaaaccaggctgt
tctggcatcattaaaggccatttgcctatcaattttataccgccacttactcacaactac
ccattagtacaaacttttcgaatcactaaaccatctaattatgccagaactatttttatc
gaggcactacaagaagcaggcatcaacgtttcatcgattgataaaaccaaagaaaatccg
aaaaaactactaaaatctactaacttgtacaataagaataacaaaattgctgctttgaaa
tcattgccattgggagagcatgtaaaatatattctcaaagttagttataatatcggagca
gataccagcctggtgttgtacggactaacaaaaggcgcgcgctccatgattgaaagtcta
aacgtggaaaaaaaaatcctggataaaaaatatggcatatccccatcagaatatcatttt
attgatggcagcggcggcggcgaaacgaaggcaaccaataccgctataataaaatggctt
actataatgtctaaaagaccagtatttaacatattttacaatagtctgcctattcttgca
gtagatggttcacttggctcaattaataactttcaatcagatccatcgctttctggggcg
acaggtcgagtgcatgcaaaaactggaacttatgtattgggaaatgagtcgggtatgtta
gttaaggggcgctctcttgctggttacattattagtaaaaaaaatcaccgacttgcattt
gccttagttgttaataatatacctatacagtcactagaagatttatttgctgtagctcag
gatcaaggcataatagcatcaattctatggcgagattattga

DBGET integrated database retrieval system