KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_2520Help
Entry
LP6_2520          CDS       T02689                                 

Gene name
lepB
Definition
(GenBank) effector protein B, substrate of the Dot/Icm secretion system
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepB_N LepB_GAP_N LepB_GAP_C
Motif
Other DBs
NCBI-ProteinID: AGN15410
LinkDB All DBs
Structure
PDB: 

Position
2859762..2863646
Genome map
AA seq 1294 aa AA seqDB search
MLIYQGKEIVRFKEKTGGKNKSDVDGFYKDNDGGKFFIKKPGDPRELFTELFAGLLLKEF
MKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKVIGTSSGDGKDRNTLKETL
FGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLNGEEKEKSKQFGRIDWGDA
FRYFAHPNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPE
LLVKIVTSALKNIPADLIDEKTKIQLAAYMCMDSFKEATFGTEGNCKDFAIAMATLLENR
LGKIAVLKDMSPLSNPEELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSF
DSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFV
PYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINT
LKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYP
IDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDP
AGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKRQTIEFEELEATLIQIKEKY
QLLEKMAEQSEHEKSSAQSIIRSLNLELSQLKLQLQEQEKLQFQLKELKEKIHEQTTLSK
RLGEELQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKERSLHKTLEEKQL
QVQQLEEQLAEKEKENLALKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLQLQ
LKSLRKQIQEQTLVVEGLKEELQKQKKSNTHQEETIERITKEKSLADSALESLRKEMYEL
TRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKGKASAKRTVASL
REQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELV
SANQELGKQNQSLSKENLHNKNTVEDLKKKLNELNVQLEQLHQSSNEKEQTIRKLREELI
KKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIIAQSKEAEKRYQQALQQ
KKGIYFARMERVSPIYLQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKNYLDNNE
SDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKAT
TGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgttaatttatcaaggtaaagaaatagttcgatttaaagaaaaaacggggggtaaaaat
aaaagcgacgtcgatggtttttataaagacaatgatggcgggaaattttttataaaaaaa
ccaggtgaccctcgtgaactattcacggaattatttgccggtttgttattaaaagaattc
atgaagcgagggttgattgatgaaagttattttccatcattgatttgcgcggatgtcatt
caatttgaagacaagtcctatgggctcatccaaccactggtttcatttgatgaattacat
aaagtgattggaacgagctctggtgatggcaaagatcgtaatacactaaaggaaaccctt
tttgggccaggttattatgctggtattacgaaacaaaataaatactttggcctttctatg
gcccttatgttttctttattgttgggagcccatagtgtacatagtggcaacatcgttgta
ctcaacggagaggaaaaagaaaaaagcaaacaatttggccgaatagattggggagacgca
ttccgttatttcgctcatcctaacaataatgacaatctcctttatgcttatgaaaacaga
ggttggtttaattataaatcactaactaaagattatttcctcaactataagaagatcaac
gggctcttccctgcgatggctgaaaaagctcgacaattgcaatccaaactcaatcctgaa
ttacttgttaaaatagtaaccagcgcactcaaaaatattccagctgatctgatagatgaa
aaaaccaaaatccaacttgccgcatacatgtgtatggattcatttaaagaggcgacattt
ggcactgagggtaattgcaaagattttgccattgccatggccacattattagaaaatcgt
ttaggaaaaattgctgttcttaaagatatgtccccattgagcaatcctgaagagctatat
caaagtattttggaattaaaacccttgacgcttcttatgacctcttcaacctctttttca
gaaaccataaatcaatgggcagacatcttaaaaactacagacatggaaaaattttcgttt
gatagtaatccaatcaacctactggaattagtcaaacaatttaatctttacgttgatgaa
ctagccatcacgtgtgaagccaataatgtctgggcaaaagaaagaatagacagcacccct
aatctgtttgctctctacgataatagcggtggtgaagcgattcacggacatgcctttgtt
ccttactacaaagaaagcattgtattgcgccgcctatttacagtagaccctaatactttc
aacttatctcgttttgctgcttttgaaggaccatgccaactctattgcaaggaacataaa
gactctgcctgggttaaaatccaaaccttactgactttaggtaatggaattattaatacg
ctaaaaataatcaaacaggctcaagcattcggaatagatgaggcagttacagagaattta
aaagcattgaaagaacaattcattgcttttcaacttgcggaagctgatataaaggaatca
ttaaaagcaccttcttttgcagagcccttgcctaataaggaaagtgagtttttttatccc
attgatgaaaaagcattagctaaaatgaatggatatcaacttgcaacgatttgtctggaa
gaactaaatagccctaaaccgtcgcctttaattgaaagaattctcagtaataaaaaattt
tggaaacgtattaactctgcttttgaaagtggtgtatttaaaggccgcacagatgatccc
gccggtaaaatagctaaaatccgtgaatggcatcaattattacagatttctggtaaaaaa
actgctggacaaattgatgagctgcaaaagatagtaatttctcttcaatcaaaaattaaa
aggcaaacgattgaatttgaggagttagaagcgactttaatccaaataaaagaaaaatat
cagttactggagaaaatggctgagcaaagcgaacatgagaaatcttccgcccaatccatt
attcgctctctgaatttagaactgagtcagcttaaattacaactgcaagagcaagaaaaa
ttacagttccagttaaaagaactcaaagagaaaatacatgaacaaactactctatccaag
cgattaggagaagagctgcaaacgcaaaagaaaaccaacacgcaccaggaagaaaccatt
caaagaatcaccaaagaaaaatcattggccgattcttcccttgagtcgcttcgaaaagaa
ctgcatgaattggcaaaaaaagaacgctctcttcataaaacgctcgaagaaaaacaatta
caagtacaacagttagaagagcaattagcagagaaagaaaaggaaaatctagccctgaaa
aaagctgacaaacaaagtcaacatgaaaaatccctggataaatccgctattgaatctcta
acctcagagcttaatcagcttaaactagaactgcaaaaacaagaaacattacaattgcag
ttaaaatctttaagaaaacaaattcaagagcaaacattagttgtagagggcttaaaagag
gagttacaaaaacaaaagaaaagcaacacacaccaggaagaaactattgaaagaattact
aaagaaaaatcattagctgattctgctcttgaatcacttcgaaaagagatgtatgaatta
actcgaaaaaacgaagaaaatcaacttaaattaacaaaacaagtccactctcttagcgaa
caacttgaagagaaacaattacaaattagagaatttgagaagcaattacaagaaaaagaa
aaacgagttgagcaaagtgagaaaggtaaagcttcagcaaaacgaactgtggcttcactt
agagagcaagtaagcaatttaaaattgcaattacagcaacttggagaggtaattcaggaa
aaagaaaaaggctcctctttgataagccagcaatccaaacaaattattgctcttcaagag
attatagaagatcaaaaaagacaattggaagaattgaaaataaaaattcaggaacttgta
tctgcaaatcaagagcttggaaaacaaaatcaaagtttgagcaaggaaaatttacataat
aagaatacagttgaagatcttaagaaaaaattgaatgaattaaatgttcaattggaacaa
ttgcatcaatcttcaaatgaaaaagaacaaaccattagaaaattgagagaagaactcatt
aagaaagattcttcgctcaaacaaaatgaggaaatgcaattagcccaaaaacatctgcaa
gaggaaattgatcgtctacaaaaagaaattaaacaacaacaattaaatacaaatcaatta
gaatctataattgctcaaagtaaagaggctgaaaaacgctatcagcaagctttacaacag
aaaaagggaatttactttgcgcgaatggaaagagtgtctcctatttatttgcaaatacag
caaattgaacaaaaggccaaagaattggaggaaagaagggaaacagaagcatcaacagcg
gcaaagacactcgcaacaaaacttcgtttagagataaaaaattatctcgacaataatgag
tccgatgaaaaaagtgccttaaactcattcaaaataaatgccaaacggcatattgaaaac
tcgaaggaaacgctaaatcaacatcgtgaagaatggaagtacctgttagccaatgttact
ttaggggtattcttgcttggaatcggttatctcgccgctattttgattaacaaagcaact
actggcaattatacctttttcagccaaactaacagcgggaaaaaattggacgcgttggaa
aaagcgatttcctccactcactccgaaacattagtttatggataa

DBGET integrated database retrieval system