KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0314Help
Entry
lpg0314           CDS       T00199                                 

Gene name
tuf2
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lpn03012]
    lpg0314 (tuf2)
   03029 Mitochondrial biogenesis [BR:lpn03029]
    lpg0314 (tuf2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpn04147]
    lpg0314 (tuf2)
Translation factors [BR:lpn03012]
 Eukaryotic Type
  Elongation factors
   lpg0314 (tuf2)
 Prokaryotic Type
   lpg0314 (tuf2)
Mitochondrial biogenesis [BR:lpn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    lpg0314 (tuf2)
Exosome [BR:lpn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   lpg0314 (tuf2)
  Exosomal proteins of breast cancer cells
   lpg0314 (tuf2)
  Exosomal proteins of colorectal cancer cells
   lpg0314 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 19831880
NCBI-ProteinID: YP_094359
Pasteur: lpg0314
UniProt: Q5ZYP5
LinkDB All DBs
Position
365435..366625
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAKAYDQIDAAPEERERG
ITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDFPGDDIPIVVGSALKALE
GEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFSISGRGTVVTGRVESGIVK
VGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLLRGTKRDEVERGQVLAKPGT
IKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGTCDLPSGVEMVMPGDNVQ
LVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaatttgaacgtaagaagccgcacgtaaacgtgggcacgattggtcac
gtagaccatggtaagacgacattgacagcagctattacaacgattatggcgaagaaatat
ggtggtacagcgaaggcgtacgatcaaattgatgctgcgccagaagaaagagagcgtggg
attactatttctacagcacatgttgaatacgaatcagcgagcagacattatgcacacgta
gactgcccgggacatgctgactatgttaagaacatgattactggtgctgcgcaaatggac
ggagcgatactggttgtatcagcagctgatggtcctatgccacaaacgagggaacacatt
ctattgtctcgccaggtaggtgttccatatattgttgtgttcatgaacaaagcggatatg
gttgatgaccctgagttattagagttagtggaaatggaagtgcgagatttattaagcagt
tacgatttcccaggggatgacatacctattgttgttggttcagctttgaaagcattggaa
ggtgaagacagtgatataggcgttaaggctattgagaaattggttgaaacaatggattca
tacattcctgagccagttagaaacatagacaagccatttttgttgccgattgaagacgta
ttttcaatttctggacgcggaacagtggtaactggtcgtgtagagagtggaattgttaaa
gttggtgaggaagttgaaattgttggaataagagacacccaaaagacgacttgtacgggt
gttgagatgttccgtaaattacttgatgaaggtcgagctggtgataacgttggtgtgtta
ttacgaggtacgaagcgagatgaagtggagcgtggacaggtattggcgaagccaggaacc
atcaagccacacaccaagtttgaagcagaagtgtatgtattatccaaggaagaaggcgga
cgtcacactccattctttaatggataccgtccacaattctatttcagaaccactgacgtg
acaggtacttgtgacttgccatcaggagttgaaatggtaatgcctggagataatgtgcaa
ttagttgttagcttgcatgctccgattgcgatggatgaaggtttaagattcgcaattaga
gagggtggccgaactgttggcgccggtgtagtcgctaaaataatcgagtaa

DBGET integrated database retrieval system