KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0422Help
Entry
lpg0422           CDS       T00199                                 

Gene name
legY
Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00500  Starch and sucrose metabolism
lpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpg0422 (legY)
Enzymes [BR:lpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     lpg0422 (legY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-GeneID: 19831988
NCBI-ProteinID: YP_094466
Pasteur: lpg0422
UniProt: Q5ZYF0
LinkDB All DBs
Position
complement(462427..463776)
Genome map
AA seq 449 aa AA seqDB search
MATFFFKTNYYQEIMLKRIFFLMIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVAS
PSQYNPNYYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQD
ILGEPKFYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDP
QSMGTIKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAV
FYEMQANLINSRLKQHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILINPQKEGVFAP
HHTFVQNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMA
EYYFTMAHNLSPNSINKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSL
TWSYVSVLRAIHLREQLENRIKTTGWNTY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcttttttaaaactaactactatcaggagattatgttgaaaaggatcttt
ttcttaatgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggtt
caaatattaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctca
ccctcgcaatacaaccccaattattattatgactggattcgagactcagccattgccatg
ggattggttgaaacatggtatgaagccagccaatctgctcgatataaaaaacttttatta
gaatacgtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggat
atattgggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgg
ccacaaaatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagctt
ctcgatcataatgaaatagattatgttaaatcacatctttataacaacaccatggaccca
caatccatgggcactatcaagatggatttggaatacatcgcacatcattggcaagatgca
aattttgacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaa
aaagcgctgaccgatggcgccattttagctcaccaacttcatgacagacaagctgctgtt
ttttatgaaatgcaagccaacttaattaacagtcgactgaaacagcatttggaccatcag
aataaaataattcaagccacattattacctcaccccggtcctcaaaaaacactagagctt
gattcgtccgtcatgttgggtattttaattaacccacaaaaagaaggtgtttttgcccca
catcacacctttgtgcaaaatactgcaaaggctttgcatgagcaatttaatttgatgttt
cctattaataaaaaccgttctggagcaatattgtttggtcgttatcccggcgatacttat
gatggctaccaaacaaacagcatagggaacccctggtttatcttaaccgctacgatggct
gaatattattttaccatggctcataatctgtccccgaacagcattaataaacttcatata
cagaactatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgat
ctgaatttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttg
acctggagttacgtttccgtcttgcgagctattcatttaagagaacaattggaaaataga
ataaaaactacgggctggaatacctattag

DBGET integrated database retrieval system