KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0991
Entry
lpg0991           CDS       T00199                                 

Definition
(RefSeq) exported membrane protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Motif
Pfam: Rootletin Apolipoprotein SHE3 TTKRSYEDQ HAP1_N YabA APG6_N V-SNARE Atg14 Flagellin_N DHC_N1 ALMT Cluap1 Phage_GPO COG2 Fzo_mitofusin PMC2NT V_ATPase_I Seryl_tRNA_N FapA DUF1664 Baculo_PEP_C Sec2p PIN_8 Exonuc_VII_L Helo_like_N FAM76 ABC_tran_CTD
Other DBs
NCBI-GeneID: 19832557
NCBI-ProteinID: YP_095024
Pasteur: lpg0991
UniProt: Q5ZWU4
LinkDB
Position
complement(1085551..1086810)
AA seq 419 aa
MNKNKGIKILSGSVVFAVVMILINSRHSTPIHDDTPNPNNFHEAITSQFNDNIRDVSARL
LETEKKLEQMHKENKSLQKQLKQPIQEASHTLQDELQTLKEKLSALTDHQTQSYPMEGNQ
ASISGRIKDLDGLLDKAPIESKIFAEQDTTTKEEAPTKTPFYTIPAGSDFSKVTLLSALM
GEVPVEGKLMQPLFPFTAMVSRGDLMTANGMQLPEEIIGMKISGYSIGVGSFLDNISCVR
AYVTAALFVFEDGHFVSIGQEQMKSSAELVNNDSIGYLTTQFGNPCIKGQYITNAPRVLT
AFMAAGGIQGAGNALSKWQMSYQAEGGSAIATPTGDLAHFAAGGAINEGSQKITDWLEKR
IQGSFDMVFVPASIRSHSGFIPNQFNLHFSQTIAIDKEHQGRVLDYGYHQQKNFDNALR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaacaaaaacaaaggcattaaaatcttatctggatcggtggtttttgcagtcgtcatg
attcttatcaatagccgtcatagtacgcctatccatgatgacacacctaatcccaacaat
tttcatgaagccattaccagccaattcaacgacaacatccgtgatgtgtctgcaagactt
ctggaaacagaaaagaaactggaacaaatgcacaaggagaataaatctctgcaaaagcaa
ttaaagcaacctatacaagaagcaagccatacgctacaagatgaattgcaaacgctgaaa
gaaaagctctcagccctgactgatcatcaaactcaatcctatcccatggaaggcaaccag
gcttctatatctggccgaattaaagatctggatggattactggataaagctcctattgag
agcaaaatttttgcagaacaagacaccacaaccaaagaagaagcgccaacaaaaacgccc
ttctataccattccagcaggtagtgatttcagtaaagtcacgctgttgtctgccttgatg
ggtgaagtgcctgttgaaggcaaactgatgcagcctttgtttccctttaccgcaatggtc
agccgtggcgatttaatgacagcaaatggtatgcaattaccggaagaaatcattggtatg
aaaatcagcggttactccattggcgtaggctctttcctcgataacatcagctgcgttcgc
gcatatgttaccgccgctttatttgtctttgaggatgggcattttgtcagtatcggccaa
gagcaaatgaaaagctctgcggagctggtgaacaatgacagcattggttatctaactact
caattcggtaatccttgcattaaaggacaatacatcactaatgctcccagagtattaaca
gcctttatggcagcaggcggaattcaaggggcaggcaacgctttatccaaatggcaaatg
agctatcaagccgaaggtggttctgccattgccacacccactggcgatttagcgcatttt
gcagctggtggtgccattaacgaaggcagccaaaagattactgattggcttgagaaaaga
atccaaggcagtttcgatatggtttttgttcctgccagcatccgcagccattcaggcttt
atacccaatcaattcaatcttcatttcagtcaaaccattgccattgataaagaacaccaa
gggagggtcttagattatggttaccatcaacaaaagaactttgataatgctttgcggtag

DBGET integrated database retrieval system