KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0998
Entry
lpg0998           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-GeneID: 19832563
NCBI-ProteinID: YP_095031
Pasteur: lpg0998
UniProt: Q5ZWT7
LinkDB
Position
complement(1089557..1090189)
AA seq 210 aa
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAITPVY
QGSLLAVLPLNAKPDWAFAIPYLNKLAINDLAKDLIEKSQQLLQILLLSSKCLLIKLIIL
FAALPLFALTMIAGLVDGLNQRAIRTACLGRESSYVFHRLNHYLKKGLVILLILWLALPV
SITPAYVFVPVSLLMGLMVAMTASRFKKYL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcagtaaagcaatattcaaggcaactgaccatgcaattaaccatagtgctattctta
ggttggttagcaattattatctgggcattgagccaatggatgctgcatggctaccccatc
gcttttgaaaaagtgaatatccttgtaaacactcaaagagaggctattactcctgtttat
caaggctcccttctggcagtccttcctttaaatgccaaaccagattgggcattcgccatt
ccctacttaaacaaactggccatcaatgatcttgccaaggacttaatcgaaaaatcacaa
caattattgcagatccttttgttaagcagcaagtgccttttgatcaaactcattatccta
ttcgctgccctgcccttatttgctttaaccatgattgcaggtctggttgacggcctaaat
caaagagcaatacgtaccgcttgtttaggtcgtgaatcctcttatgtgttccacaggctt
aatcactatttgaaaaaaggactggtgattttactcatactgtggcttgccctgcccgtt
agcatcacccctgcttatgtctttgtacctgtcagtttgttgatgggattaatggtagcc
atgacggccagccgctttaagaaatacttatag

DBGET integrated database retrieval system