KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1004
Entry
lpg1004           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Other DBs
NCBI-GeneID: 19832569
NCBI-ProteinID: YP_095037
Pasteur: lpg1004
UniProt: Q5ZWT1
LinkDB
Position
complement(1092625..1092978)
AA seq 117 aa
MFLRFNAIYGALWLSAYNNEKALEAAKLEWADSIKEFDSQVLTFAVEKIKRTQQRPPVIP
VFVELCISIQKSIKAREEALRAKPENHKRTDPQIVKSHIKEMMEKLTSPSVKEKKSC
NT seq 354 nt   +upstreamnt  +downstreamnt
ttgttcttaagatttaatgccatttatggtgccttatggctttctgcctataacaatgaa
aaagcccttgaagctgccaagctggaatgggctgacagcatcaaagaatttgatagccag
gtcttaacctttgcggtggaaaaaataaaaagaacgcaacaacgccctcccgttattcct
gtctttgtagaactttgcatcagcattcaaaaaagtattaaggcaagagaagaagctctg
cgggctaaacccgaaaaccataaaagaaccgacccacaaatcgttaaatcccacatcaaa
gagatgatggaaaagctaaccagtccctcagttaaggagaaaaaatcatgctga

DBGET integrated database retrieval system