KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2229Help
Entry
lpg2229           CDS       T00199                                 

Definition
(RefSeq) saframycin Mx1 synthetase B
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-GeneID: 19833795
NCBI-ProteinID: YP_096241
Pasteur: lpg2229
UniProt: Q5ZTD3
LinkDB All DBs
Structure
PDB: 

Position
2519995..2521740
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPNKKSCTFLNKELEETMTYEQLDQHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPKFLKIPAIALESIELNRSSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYKATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
EETMEHFYQAFKEFGFRKEAFYPCYGLAEATLLVTGGTPGSSYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQEVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETRH
AFAGKIKDDERSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggttgacgtcgtcaggttacgtgcttta
cacagccctaacaagaaaagctgtacttttctgaacaaagagttggaagagacgatgact
tatgagcaactggatcaacacgccaaagcaattgcggcaactttgcaagcagaaggagca
aaacctggggatagggtcttgttattgtttgcacctggattaccccttatccaggcattt
ttgggctgcctttatgcaggctgcattgctgtacccatttacccaccagcccaagaaaaa
ttattggacaaggcacaacgcatagttaccaactcaaaaccggtcatagtactgatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatcccaaattcctgaaa
attcctgctattgcgcttgagagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttctgcaatacacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttactggataatctgaataaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattctgacccccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattaccaaatacaaagcaact
atcagtggaagccctaacttcgcttacgattattgtgtcaaacgaatcagggaagaaaaa
aaagaagggctggatttaagttcatgggtgactgctttcaacggtgctgagccagtacga
gaagaaaccatggaacatttttatcaggcatttaaagagtttggatttcgtaaagaagcc
ttctatccatgctatggcctggctgaggccactttgttagtgacgggaggaacaccagga
agttcatacaaaacattaactctggccaaagaacaatttcaagatcatcgcgtgcatttt
gcagacgataacagtccaggcagttacaagttagtcagcagtggtaatcccattcaagaa
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgccaaaggatattggaatcaacccgaagaaacaaggcat
gcgttcgcaggaaaaattaaagacgatgagcgtagcgcaatctatttaagaaccggggac
ttgggctttctccatgaaaatgagttatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattatcctcaggacatagagttcagcctgatgcattctccgctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaggagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacatactaccagcggaaaaattcgcaggaatttttgtcga
aaacatcttttggataaaactctgccaatagtggctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system