KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_0482Help
Entry
LPO_0482          CDS       T02175                                 

Definition
(GenBank) putative Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00500  Starch and sucrose metabolism
lpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPO_0482
Enzymes [BR:lpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LPO_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: CCD04588
LinkDB All DBs
Position
complement(485306..486589)
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLEHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAVFYEMQANLINSRLQQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSLNSSNKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TMGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctcaccctcg
caatacaaccccaattattattatgactggattcgagactcagccattgccatgggattg
gttgagacatggtatgaagccagccaatctgctcgatataaaaaacttttattagaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgagcccaaattttatatcaatggcaatccttttgatggggaatggggacgaccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgaa
cataatgaaatagattatgttaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcacatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttggctcaccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacttaattaacagtcgactgcaacagcatttggaccatcaaaataaa
ataattcaagccacattattacctcaccccggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaactaacccacaaaaagaaggtgtttttgccccacatcac
acctttgtgcgaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcccggcgatacttatgatggc
taccaaacaaacagcatagggaacccctggtttatcttaacagctacgatggccgaatat
tattttaccatggctcataatctgtccctgaacagcagtaataaacttcatattcagaac
tatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagagcaattggaaaatagaataaaa
actatgggctggaatacctattag

DBGET integrated database retrieval system