KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_1470Help
Entry
LPO_1470          CDS       T02175                                 

Definition
(GenBank) Peptidase S13, D-Ala-D-Ala carboxypeptidase C precursor
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPO_1470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lpo01002]
    LPO_1470
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpo01011]
    LPO_1470
Enzymes [BR:lpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPO_1470
   3.4.21  Serine endopeptidases
    3.4.21.-  
     LPO_1470
Peptidases and inhibitors [BR:lpo01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   LPO_1470
Peptidoglycan biosynthesis and degradation proteins [BR:lpo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LPO_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CCD05504
LinkDB All DBs
Position
1506369..1508018
Genome map
AA seq 549 aa AA seqDB search
MMKRYSKRLLTYIYLLMKSIPLVFTMQQLSYSTDKIPIPINKLPDDLNKVMNKSIYKKAL
WGLRVVDLDTGNVLLNLNSGTQFYIGSVRKIFSVGELLNERGADYQSVTTVHYDGVLHNG
NLNGNLVLVASGDLTMGGRTLPDGHVAITEYDHNEANSLGNAIITQTNLLAGYQNLAKQV
YKAGIRSISGDIVIDDRLFEPFNFRGEFDVTPIFINDDVVDIVILPSLINENANVSWLPH
SSAFTVINQLLTVNPHEKYNLELESKLPACIGKPGCSGIIKGHLPINFIPPLTHNYPLVQ
TFRITKPSNYARTIFIEALQEAGINVSSIDKTKENPKKLLKSNNLYNKNNKIAALKSLPL
GEHVKYILKVSYNIGADTSLVLYGLTKGARSMIESLNVEKKILDKKYGISPSEYQFIDGS
GGGETKATNTAIIKWLTIMSKRPVFNIFYNSLPILAVDGSLGSINNFQSDPSLSGATGRV
HAKTGTYVLGNESGMLIKGRSLAGYIISKKNHRLAFALVVNNIPIQSLEDLFAVAQDQGI
IASILWRDY
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagagatactcgaaaagattactgacttatatttatttacttatgaaaagcata
cctctagtgttcacgatgcaacaactatcatatagcacagataaaatccctataccaatc
aataaactacctgatgacctaaacaaagtgatgaataaatctatttataaaaaagcgttg
tgggggttacgtgttgttgatcttgatactggtaatgtattgctgaatcttaactcaggt
acgcagttttatattggttctgtgcgcaagatatttagtgtaggcgaactattgaatgaa
agaggagctgattatcaatctgttactacagtccattatgatggtgtattacacaatggt
aatctgaatgggaatctggtactcgttgcttcaggtgatttgaccatgggaggacgaact
ttacctgatggacatgtcgctatcactgaatacgatcataacgaggcaaattcattgggt
aatgcaattattacacagactaatcttttagcaggttatcaaaatctcgctaaacaagtt
tacaaagctggcattcgctctatttcaggcgacattgtgatagacgatagattgtttgaa
ccatttaatttcaggggtgaatttgatgtaacacctattttcataaacgatgatgtagtt
gatattgtaattcttccaagtttgataaacgagaatgcaaatgtatcgtggctgccacat
tcatcggcgttcaccgttatcaaccaacttcttacagttaatccgcatgaaaaatataat
cttgaacttgagtcaaaattacctgcctgcataggtaaaccaggctgttctggcatcatt
aaaggccatttgcctatcaattttataccgccacttactcacaactacccattagtacaa
acttttcgaatcactaaaccatctaattatgccagaacaatttttatcgaggcactacaa
gaagcaggcatcaacgtttcatcgattgataaaaccaaagaaaatccgaaaaaactacta
aaatctaataacttgtacaataagaataacaaaattgctgctttgaaatcattgccattg
ggagagcatgtaaaatatattctcaaagttagttataatatcggagcagataccagcctg
gtgttgtacggactaacaaaaggcgcgcgctccatgattgaaagtctaaacgtggaaaaa
aaaatcctggataaaaaatatggcatatccccatcagaatatcaatttattgatggcagc
ggcggcggcgaaacgaaagcaaccaataccgctataataaaatggcttactataatgtct
aaaagaccagtatttaacatattttacaatagtctgcctattcttgcagtagatggttca
cttggttcaattaataactttcaatcagatccatcgctttctggggcaacaggtcgagtg
catgcaaaaactggaacttatgtattgggaaatgagtcgggtatgttaattaaggggcgt
tctcttgctggttacattattagtaaaaaaaatcaccgacttgcatttgccttagttgtt
aataatatacctatacagtcactagaagatttatttgctgtagctcaggatcaaggcata
atagcatcaattctatggcgagattattga

DBGET integrated database retrieval system