KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_1522Help
Entry
LPO_1522          CDS       T02175                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 6a)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00550  Peptidoglycan biosynthesis
lpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPO_1522 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lpo01002]
    LPO_1522 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpo01011]
    LPO_1522 (dacC)
Enzymes [BR:lpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPO_1522 (dacC)
Peptidases [BR:lpo01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LPO_1522 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:lpo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LPO_1522 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CCD05553
LinkDB All DBs
Position
1558129..1559352
Genome map
AA seq 407 aa AA seqDB search
MTRATSFLLTLLFFITLFVQSTNSMADEVLPSSDLQKPSPTVTTKPFTTPAAPLLNAKAY
ILIDVNSGKVIAEKNSEEKLPPASLTKMMTLYVISNALKSGQIHLNDMVRVSRDAWQTGG
SRMFIKEGDQVSVEDLLKGIIVDSGNDACVAMAEHLGGSENAFTDIMNQQAQNLGMKNSH
FTDSTGLPDPNLYTTAKDLAILGRALILDFPEYYGWYKQKWFTYNGIRQPNRNRLLWRDS
QVDGIKTGHTNDAGYCLVSSAKRNNMRLLAVVLGEPSDSVRADDSEKLLNYGFRFFETHQ
LYKSGQSIAELPLYKGTSDKVAVGLTEDQFITIPAGQYERLNISTKISNDLQAPIKKGDK
VGDIIVQFNNNIVSSKPLYALQTVESGGFYTRTKDSIRLAFKRWFGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagcaacgtcttttttattgacgctattattttttattacgttatttgtacag
tctaccaattcaatggctgatgaagtgctcccctcctctgatttgcagaagccttctcca
acagtcacaacgaaaccttttacaactccggctgctccattgcttaatgccaaagcttat
attttaattgatgtgaatagtggaaaagtaattgcagaaaagaatagtgaggaaaaatta
ccacctgccagtttgaccaaaatgatgacgctttatgtcatttctaatgcattgaagagc
ggacaaatccatcttaatgatatggtaagagtaagccgtgatgcatggcagacaggtggc
tctcgtatgtttataaaagagggagatcaggtctctgttgaagaccttttaaaaggcatt
atagtagactctggtaatgacgcttgtgtggcaatggcagagcatcttggtggttccgaa
aatgcttttaccgacattatgaatcagcaagctcaaaatctgggtatgaaaaatagtcat
tttacagacagtactggattacctgatcctaatctatatacaactgctaaagatttggcg
attttaggccgagccttaatactcgatttccctgaatactatggctggtataaacaaaaa
tggtttacatataacggtatacgccaacctaatcgaaatcgtttgttgtggcgagatagc
caagttgatggtataaaaacaggccacaccaatgatgctggatattgtctagtatcttct
gcaaagcgtaataatatgcgtttattagctgtggttttaggggaacccagtgattctgtg
cgtgctgatgacagtgaaaaattattaaattacggatttagattttttgaaacacatcaa
ttatataaatccgggcaatcaattgctgaattaccgctttacaaaggaacttctgataaa
gttgctgtgggtttaacagaagatcaatttattacgatacctgccggtcaatatgaaaga
ttaaatatttcaactaaaatttctaatgatttacaagctcccataaagaaaggcgataaa
gttggagatattattgtgcaatttaataacaatatcgtttcaagcaaaccgctttatgct
ttgcaaacagtggagtcaggtggattctataccagaacaaaagattcgataaggttagca
tttaagcgatggttcggctcctag

DBGET integrated database retrieval system