KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_2680Help
Entry
LPO_2680          CDS       T02175                                 

Gene name
lepB
Definition
(GenBank) effector protein B, substrate of the Dot/Icm secretion system
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepB_N LepB_GAP_N LepB_GAP_C
Motif
Other DBs
NCBI-ProteinID: CCD06639
LinkDB All DBs
Structure
PDB: 

Position
2796590..2800474
Genome map
AA seq 1294 aa AA seqDB search
MLTYQGKEIVRFKEKTGGKNKSDVDGFYKDSDGRKFFIKKPGDPRELFTELFAGLLLKEF
MKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKIIGTSYGDGSDRNTIKETF
FGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLKGEGEEKSKQFGRIDWGDA
FRYFAHRNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPE
LLIEIVTSALKNIPADLIEEKTKIQLAAYMCMDSFKEVTFGPKGNCKDFAIAMATLLENR
LGKIAVLKDMSPLSNPEELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSF
DSNPINLLELVKQFNIYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFV
PYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQRYCKEHKDSAWVKIQTLLTLGNGIINT
LKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADVKESLKAPSFTEPLPDKESEFFYP
IDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDP
AGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKKQTIEFEELEATLIQIKEKY
QLLEKMAEQSEHEKSSAQSIIRSLNLELGQLKLQLQEQEKLQFQLKELKEKIHEQTTLSK
QLGEELQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKEHSLHKTLEEKQL
QVQHLEEQLAEKEKENLALKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLQLQ
LKSLRKQIQEQTLLVESLKEELQKQKESNTHQEETIERITKEKSLANSALESLRKEMHEL
TRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKEKASAKRTMASL
REQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELV
SANQELGKQNQSLSKENLHNKNTVEDLKKKLNELNVQLEQLHQSSNEKEQTIRKLREELI
KKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIIAQSKEAEKRYQQALQQ
KKGIYLARMERVSPLYLQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKSYLDNNE
SDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKAT
TGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgttaacttatcaaggtaaagaaatagttcgatttaaagaaaaaacaggtggtaaaaat
aaaagtgatgtcgatggtttttacaaagacagcgatggccggaaattttttataaaaaaa
ccgggcgaccctcgtgagctattcacggaattatttgcaggcttgctattaaaagagttc
atgaagcgaggattgattgatgaaagctattttccatcattaatttgcgccgatgtcatt
caatttgaagacaaatcctatggcctgatacagccactggtttcatttgatgaattacac
aaaatcattggaacaagctacggtgatggcagtgatcgtaatacgataaaggaaaccttc
tttgggccaggttattatgccgggatcacaaaacaaaataaatattttggcctttctatg
gcccttatgttttctctattgctgggagcccatagtgtacatagtggcaatatcgttgta
ctcaaaggagaaggagaagaaaaaagcaaacaatttggccgaatcgattggggagatgcc
ttccgttatttcgctcatcgaaacaataatgacaatctcctttatgcttatgaaaacaga
ggttggtttaattataaatcactaactaaagattatttcctgaactataagaagatcaat
ggcctcttccctgcgatggctgaaaaagcccgacaattgcaatccaaactaaatcctgaa
ttgcttattgaaatagtaactagcgcactcaaaaatattccagctgatctgatagaagaa
aaaaccaaaatccaacttgctgcctacatgtgtatggattcatttaaagaggtaacattt
ggcccaaagggtaattgcaaagattttgccattgccatggccacattattagaaaatcgt
ttaggaaaaattgctgttcttaaagatatgtccccattgagcaatcctgaagagctgtat
caaagtattttggaattaaaacccttgacgcttcttatgacctcttcaacctctttttca
gaaaccataaatcaatgggcagacatcttaaaaactacagacatggaaaaattttcgttt
gatagtaatccaatcaacctactggaattagtcaaacaatttaatatttacgttgatgaa
ctagccatcacgtgtgaagccaataatgtctgggcaaaagaaagaatagacagcacccct
aatctgtttgctctctacgataatagcggtggtgaagcgattcacggacatgcctttgtt
ccttactacaaagaaagcattgtattgcgccgcctatttacagtagaccctaatactttc
aacttatctcgttttgctgcttttgaaggaccatgccaacgctattgcaaggaacataaa
gactctgcctgggttaaaatccaaaccttactgactttaggcaatggaattattaatacg
ctaaaaataatcaaacaggcccaagcattcggaatagatgaggcagttacagagaattta
aaagcattgaaagaacaattcattgcttttcaacttgcggaagctgatgtaaaggaatca
ttaaaagcaccttcttttacagagcccttgcctgataaggaaagtgagtttttttatccc
attgatgaaaaagcattagctaaaatgaatggatatcaacttgcaacgatttgtctggaa
gaactaaatagccctaaaccgtcgcctttaattgaaagaattctcagtaataaaaaattt
tggaaacgtattaactctgcttttgaaagtggtgtatttaaaggccgcacagatgatccc
gccggtaaaatagctaaaatccgtgaatggcatcaattattacagatttctggtaaaaaa
actgctggacaaattgatgagctgcaaaagatagtaatttctcttcaatcaaaaattaaa
aagcaaacgattgaatttgaggagctagaagcgactttaatccaaataaaagaaaaatat
cagttgctggagaaaatggctgagcaaagcgaacatgagaaatcttccgcccaatccatt
attcgctctctgaatttagaactgggtcagcttaaattacaactgcaagagcaagaaaaa
ttacagttccagttaaaagaactcaaagagaaaatacatgaacaaacgactctatccaag
caattaggagaggagctgcaaacgcaaaagaaaaccaacacgcaccaggaagaaacaatt
caaagaatcaccaaagaaaaatcattggccgattcttcccttgagtcgcttcgaaaagaa
ctgcatgaattggcaaaaaaagaacactctcttcataaaacgctcgaagaaaaacaatta
caagtacaacacttagaagagcaattagcagagaaagaaaaggaaaatctagccctgaaa
aaagctgacaaacaaagtcaacatgaaaaatccctggataaatctgctattgaatctcta
acctcagagcttaatcagcttaaactagaactgcaaaaacaagaaacattacaattgcag
ttaaaatctttaagaaaacaaattcaagagcaaacattacttgtagagagcttgaaagag
gagctacaaaaacaaaaggaaagcaacacacaccaggaagaaactattgaaagaatcact
aaagaaaaatcattggccaattctgctcttgaatcgcttcgaaaagagatgcatgaatta
actcgaaaaaacgaagaaaatcaacttaaattaacaaaacaagtccactctcttagcgaa
caacttgaagaaaaacaattacaaattagagaatttgagaagcaattacaagaaaaagaa
aaaagagtcgagcaaagtgagaaagagaaagcttccgcaaaacgaactatggcttcactt
agggagcaagtaagcaatttaaaattgcaattacagcaacttggagaggtaatccaggaa
aaggaaaaaggctcctctttgataagccagcaatccaaacaaattattgctcttcaagag
attatagaagatcaaaaaagacaattggaagaattgaaaataaaaattcaggaacttgta
tctgcaaatcaagagcttggaaaacaaaatcaaagtttgagcaaggaaaatttacataat
aagaatacagttgaagatcttaagaaaaaattgaatgaattaaatgttcaattggaacaa
ttgcatcaatcttcaaatgaaaaagaacaaaccattagaaaattgagagaagaactcatt
aagaaagattcttcgctcaaacaaaatgaggaaatgcaattagcccaaaaacatctgcaa
gaggaaattgatcgtctacaaaaagaaattaaacaacaacaattaaatacaaatcaatta
gaatctataattgctcaaagtaaagaggctgaaaaacgctatcagcaagctttacaacag
aaaaagggaatttaccttgcgcgaatggaaagagtgtctcctctttatttgcaaatacag
caaattgaacaaaaggccaaagaattggaggaaagaagggaaacagaagcatcaacagcg
gcaaagacactcgcaacaaaacttcgtttagagataaaaagttatctcgacaataatgag
tccgatgaaaaaagtgccttaaactcattcaaaataaatgccaaacggcatattgaaaac
tcgaaggaaacgctaaatcaacatcgcgaagaatggaagtacctgttagccaatgttact
ttaggggtattcttgcttggaatcggttatctcgccgctattttgattaacaaagcaact
actggcaattatacctttttcagccaaactaacagcgggaaaaaattggacgcgttggaa
aaagcgatttcttccactcactccgaaacattagtttatggataa

DBGET integrated database retrieval system