KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_3302Help
Entry
LPO_3302          CDS       T02175                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Brite
Enzymes [BR:lpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LPO_3302 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCD07219
LinkDB All DBs
Position
3422833..3423411
Genome map
AA seq 192 aa AA seqDB search
MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESLTLEEIIMKA
KGGIFNNAAQVWNHTFYWHSMSPNGGGEPKGRLAEAINKSFGSFAAFKEQFSQTAATTFG
SGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIEAFWS
LVNWDFASSNLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaccctgccgcaattaccttatgcattggatgcactggcccctcatgtttcc
aaagaaaccttggaataccattatggtaaacaccataacacttacgttaccaacttaaat
aaattaattcccggaacagaatttgaatccctgactctggaagagatcatcatgaaagct
aaaggtggtatttttaacaatgccgctcaggtttggaatcacaccttttattggcacagc
atgagccctaatggtggaggtgagccaaaaggcaggctggcggaagccattaataaaagc
tttggttcttttgcagcattcaaagaacaattttcacaaacagctgctacaacattcggt
tccgggtgggcatggctagtccaggatcagtcaggggctttaaaaattatcagcacaagc
aatgctggaacaccaatgactgaaggattaaatgccttattaacttgtgacgtatgggaa
cacgcctattacatcgattatagaaataggcgcccggattatattgaagccttttggtca
ttagttaattgggattttgcgagcagtaatctgaaataa

DBGET integrated database retrieval system