KEGG   Legionella pneumophila Paris (serogroup 1): lpp1702Help
Entry
lpp1702           CDS       T00209                                 

Gene name
gatB
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase (subunit B)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00970  Aminoacyl-tRNA biosynthesis
lpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lpp1702 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpp03029]
    lpp1702 (gatB)
Enzymes [BR:lpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     lpp1702 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     lpp1702 (gatB)
Mitochondrial biogenesis [BR:lpp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    lpp1702 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CAH12854
Pasteur: lpp1702
UniProt: Q5X4H4
LinkDB All DBs
Position
1916104..1917537
Genome map
AA seq 477 aa AA seqDB search
MEWDTVIGLEVHAQLKTKSKLFSGASTAFGATPNSQTSFIDAGLPGVLPVLNEQAIIMAI
QFGLAIHGTINDLSVFERKNYFYPDLPKGYQISQYQKPIVTNGYLNIQLGNNLEKTVHIA
RAHLEEDAGKSLHDAHTDYTGIDLNRAGTPLLEIVTTPCLYSAEEAVNYLKTLHQLVRFL
GICDGNMQEGSFRCDVNLSIKPKGSSVLGTRTELKNLNSFRFIEKAIAFEQARHQDILER
GLSVIQETRLYNPDNNTTQAMRGKENENDYRYFPDPDLLPIDIDKEQIEEIKNNLPDLPE
AIYKELKNTPSLNDEDINFILSSPDTYQYYKKIKSLCPAADKTIINWLKGQYAAFLNEHN
LTFETPPISAKTMAAFLSKIHEKKISSSIAKNIFSMLCAGEEDIDAIIEREGYQQQNDNS
ALEEIVEQIIKQYPEQVIEYKAGKEKLLAFFIGQAMKQTKGKANPEQINLLLKKHLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggataccgtcattggtcttgaggtacatgctcaattaaaaaccaaatcaaaa
ttattttcaggagcatctactgcttttggtgccacccctaactcgcaaacgagttttatc
gatgctggtttgcctggtgttctccctgtattaaacgaacaagccatcataatggctatc
caatttggtttggcaattcatggaaccattaatgatctgtctgtttttgagcgtaaaaat
tatttttatcctgacttgcccaagggctatcaaatcagtcagtatcaaaaacccattgtt
actaatggttatttaaatatacagcttggtaataacctggaaaaaacagtccatattgca
cgcgctcatttagaagaagatgctggcaaatccctacacgatgcccatactgattacacc
gggatcgacctcaacagagcaggtaccccattattggaaatagtcacaaccccttgtttg
tactctgctgaagaggcggttaattatttaaaaactctacatcaattagtgagattcctt
ggaatatgcgatggcaatatgcaagaaggttcttttcggtgcgacgtcaatctgtctata
aaacctaaaggcagctcagttttaggcacgcgaacagaacttaagaatctgaattcattt
cgttttattgaaaaagccattgcttttgaacaagcaagacatcaggatatattggaaaga
ggtctgtcagtcatccaggagactcgcctttacaatcctgacaataacacaactcaggcg
atgagaggcaaggaaaatgaaaatgattaccgttattttcctgatcctgatttattacca
attgatattgacaaagaacaaattgaagagattaaaaataacctgccggacttgcctgaa
gcaatttacaaagagttaaaaaacactccgtccctaaatgatgaagacattaatttcata
ttatcatcaccggacacttatcaatattacaaaaaaattaaatccctttgtccggctgct
gataaaacaattatcaactggttaaaaggccaatatgccgcctttcttaatgaacacaac
ctaacctttgaaacaccaccaatttcagctaaaaccatggctgctttccttagcaaaatt
catgagaaaaaaatctcttccagtattgctaaaaatattttcagtatgctttgtgcaggt
gaagaagatatcgatgcgattattgaacgcgaaggctaccagcaacagaatgacaactcg
gcactggaagaaatagttgagcaaataatcaaacaatatcccgaacaagttatagaatac
aaagccggtaaagagaaattattagctttttttatcggacaagcgatgaaacaaactaaa
gggaaagcaaatcccgagcaaatcaatctgttattaaaaaaacatcttggatga

DBGET integrated database retrieval system