KEGG   Legionella pneumophila Paris (serogroup 1): lpp2009Help
Entry
lpp2009           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01130  Biosynthesis of antibiotics
lpp01230  Biosynthesis of amino acids
lpp02024  Quorum sensing
Module
lpp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpp2009
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lpp2009
Enzymes [BR:lpp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     lpp2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: CAH13161
Pasteur: lpp2009
LinkDB All DBs
Position
2273040..2274377
Genome map
AA seq 445 aa AA seqDB search
MQEWSPTTWQKYSYLQAASYADEEQLNKVVEQLSLLPPLVTSGEIKHLKNEIAQAGRGNA
FILQGGDCAESFNDCRSEVISNKLKIILQMSLILLYGLRKPIIRIGRIAGQYAKPRSSDY
ETINGVTLPSYRGDIVNSPEFTATAREPNPKLLLQAYSCSAMTLNFIRALLDGGFADLHH
PQRWDLGFVEHSPQKNEYQHIVDSIEDALDFLNAIDGIHSSSISKVDFYTSHEALHLHYE
QALTRQLKDGKWYNLSTHLPWIGMRTAQTDSAHLEFLRGVQNPIGIKIGPAATPEWLSEV
LSVANPQKEEGRVLLYTRLGAKLIDRLLPPLIDTVRKSKIPVTWSCDPMHGNTETTEDGT
KTRHFDNILSELKQALEIHRSMGSYLGGVHFELTGDNVTECIGGARGLAPHDLKTAYHSL
VDPRLNYEQSLEMAIQLSHQFRSEP
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatggtcgccaactacatggcagaaatattcgtatttgcaggcagcttcatac
gctgatgaagagcaattaaataaagtggtagaacaattaagtttgctacccccattggtt
actagcggtgaaatcaaacatttaaaaaatgaaattgcccaggctggccgaggtaatgct
tttattctgcagggtggtgattgcgctgaatcttttaatgactgtcgttcagaagtcata
agcaataaattaaaaatcattcttcaaatgagcctaatcttattatatggcttgcgtaaa
ccaattattcgtatcggaagaatagctggacaatatgcaaaaccacgctcctcagattac
gaaaccataaatggagttactttacccagttatcgtggagatatcgttaattcacctgaa
tttactgccactgccagggagcctaatcctaaattattacttcaggcatacagttgttct
gccatgactttaaattttatccgagcgttgctggatggcggttttgctgacctgcatcac
cctcaacgctgggatttaggttttgttgaacactcccctcagaagaacgaataccaacat
attgtagactctattgaagacgccctggattttttgaatgccatagatggaatacattcg
agtagcataagtaaagttgatttttacacctctcatgaagcgttgcatttacattatgag
caagcattaacaagacagttgaaagatggaaaatggtacaatctttcaactcatttaccc
tggattggaatgcgtacggctcaaacggacagtgcacatcttgagtttctacgaggggta
caaaatccaataggcattaagataggcccagcagctacacctgaatggttatcggaggtg
ttaagcgtagccaatcctcaaaaagaagaaggacgagttttactttatactcgcctggga
gcaaaacttatcgaccggttgttacctccactgattgacacagtaaggaaaagcaaaatt
ccagtcacatggtcatgtgaccctatgcatggcaataccgaaacaacagaagacggtact
aaaacacgtcacttcgataacattttatcggaattaaaacaagctttggaaattcatcgc
agcatgggtagctacctcggaggtgtccattttgagctaactggtgacaatgtaacagag
tgtatcggaggcgctcgtggattagctccccatgacctcaaaactgcctatcacagcctg
gttgatccaagattaaactatgaacaatctctggaaatggccatccaattaagccatcaa
ttcagaagtgaaccttaa

DBGET integrated database retrieval system