KEGG   Legionella pneumophila Paris (serogroup 1): lpp2181Help
Entry
lpp2181           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: CAH13333
Pasteur: lpp2181
LinkDB All DBs
Structure
PDB: 

Position
2506864..2508609
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPNKKSCTFLNKELEETMTYEQLDQHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPKFLKIPAIALDSIELNRSSSWQPTSIKGNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
AETMEHFYQAFKEFGFRKEAFYPCYGLAEATLLVTGGTPGSPYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETKH
AFAGKIKDDERSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggttgacgtcgtcaggttacgtgcttta
cacagccctaacaagaaaagctgtacttttctgaacaaagagttggaagagacgatgact
tatgagcaactggatcaacacgccaaagcaattgcggcaactttgcaagcagaaggagca
aaacctggagatagggtcttgttattgtttgcacctggattaccccttatccaggcattt
ttgggctgcctttatgcaggctgcattgctgtacccatttacccaccagcccaagaaaaa
ttattggacaaggcacaacgcatagttaccaactcaaaaccggtcatagtactgatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatcccaaattcctgaaa
attcctgctattgcacttgatagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagggcaatgacattgcgtttttacaatacacctccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttactggataatctgaataaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattctgacacccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattactaaatacagagccact
attagtggcagccccaacttcgcttacgattattgtgtcaaacgaatcagggaagaaaag
aaagaagggcttgatttaagttcatgggtgaccgctttcaacggtgctgagccagtacga
gcagaaaccatggaacatttttatcaggcatttaaagagtttggatttcgcaaagaagcc
ttctatccatgctatggcttggctgaggctactttgttagtgacgggaggaacaccagga
agtccatacaaaacattaactctggccaaagaacaatttcaagatcatcgcgtacatttt
gctgacgataacagtccaggcagttacaagttagtcagcagtggtaatcctattcaagca
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgccaaaggatattggaatcaacccgaagaaacaaagcat
gcgttcgcagggaaaattaaagacgatgagcgtagcgcaatctatttaagaaccggggac
ttgggctttctccatgaaaatgagttatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattatcctcaggacatagagttcagcctgatgcattctcctctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaagagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacatactaccagcggaaaaattcgcaggaatttttgccga
aaacatcttttagataaaactctgccaatagtggctacctggcagctcaataaaattgag
gaataa

DBGET integrated database retrieval system