KEGG   Legionella pneumophila Paris (serogroup 1): lpp2297Help
Entry
lpp2297           CDS       T00209                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lpp2297 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAH13450
Pasteur: lpp2297
LinkDB All DBs
Position
2639702..2640190
Genome map
AA seq 162 aa AA seqDB search
MNKSGIILISTILFSSMAIADDLTAPIYTTGPKPVAIGKVTFTQTPYGVLITPDLTNLPE
GPHGFHLHKNADCGNHGMDAEGHYDPQNTNSHQGPYGNGHLGDLPVLYVTSNGKAMIPTL
APRLKLSDMHNLAVMIHANGDTYSDNPPQGGGGDRIACGVIK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaggaataatattaattagtactattttattctcaagcatggctattgcc
gatgatcttacagcaccaatttacacaactggtcccaaaccagttgcaataggcaaggta
accttcacacaaaccccttatggtgttttgattacaccagacttaactaaccttcctgaa
ggtccgcatggtttccatttacataaaaatgcagattgtggtaaccacggaatggatgca
gaaggacattatgatcctcaaaataccaatagccaccaaggcccttatggtaacgggcat
ttgggagatttacctgttttatatgtcacaagtaatgggaaagcaatgattcctacttta
gctcctcgtttgaaattaagtgatatgcacaatttagctgtcatgatccatgccaatgga
gacacttacagtgacaatcctccacaaggtggcgggggggaccgtatagcttgcggcgtc
attaaatag

DBGET integrated database retrieval system