KEGG   Lactobacillus paracasei N1115: AF91_07025Help
Entry
AF91_07025        CDS       T03050                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase B
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
lpq  Lactobacillus paracasei N1115
Brite
KEGG Orthology (KO) [BR:lpq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpq03009]
    AF91_07025
Enzymes [BR:lpq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     AF91_07025
Ribosome biogenesis [BR:lpq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AF91_07025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 SUKH-3
Motif
Other DBs
NCBI-ProteinID: AHJ32947
LinkDB All DBs
Position
complement(1404067..1404810)
Genome map
AA seq 247 aa AA seqDB search
MTTKTERLQKIIANAGIASRRHAETLIATGHVKVNGQIETEMGIKIGPHDEVEVDGVPIG
KEAKRYFLFYKPRGVISAVQDNKGRDVVTDYFKDITERLYPVGRLDYDTSGLLVMTNDGD
LANHLMHPRYALEKKYVAKVQGVPNRPALAPLKTGVEVDGKMTAPAKVDIISTDKAKKTA
IVSLTIHQGMNHQVKKMFKAVGFPVLKLSREAYGNLTLVGLQPGEHRPIKPQELQALRKL
AGESENK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaaaactgaacggcttcaaaaaattatcgcaaatgccggtattgcttcgcgt
cgacatgcggaaacgttgattgcaactggccatgtcaaagttaatggccaaattgaaact
gaaatgggcatcaagattggtccgcatgatgaagtcgaagtggatggcgtgccgattggc
aaagaggctaagcgctactttctcttttataaaccgcgcggcgtgattagtgctgttcaa
gataataagggacgtgatgtcgtcaccgattactttaaggatattactgagcgtctttat
ccagttggccgattagattacgatacaagcggcttacttgtgatgacaaacgatggcgat
ttagccaaccatttgatgcatccacgttacgcgcttgagaaaaaatatgtagccaaggtt
caaggtgtaccgaatcgacctgccttggctccgctcaaaacaggtgtcgaggttgatggc
aagatgactgcgcctgctaaagtagacattatctcgactgataaggctaaaaaaacggcg
atcgtatctttgaccattcatcaaggcatgaatcatcaggttaaaaagatgtttaaagca
gtcggcttcccagttctaaaactatctcgggaagcgtatggcaacttaactttggtgggg
ttacagccaggtgaacatcggccaatcaagccgcaagaactgcaagccttgcgaaaacta
gcgggtgaatcggaaaataagtag

DBGET integrated database retrieval system