KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0259Help
Entry
LBP_cg0259        CDS       T02670                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpr02000]
    LBP_cg0259
Transporters [BR:lpr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter
    LBP_cg0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 AAA_15 AAA_23 AAA_29 AAA_21 SbcCD_C RsgA_GTPase AAA_33 AAA_24 G-alpha Pox_A32 AAA_25 Zeta_toxin AAA_30 MMR_HSR1 NACHT AAA_16 DUF87
Motif
Other DBs
NCBI-ProteinID: AGL63005
LinkDB All DBs
Position
276062..276721
Genome map
AA seq 219 aa AA seqDB search
MLKVNDLGYWYDRQENSLFENVNLEFKSGTSYAIVGQSGSGKTTFLSLLAGLDKPRAGQI
ELNGEPINKIGLTNYRKSKVAIVFQSYNLLTYMSPLNNLMTAMAITNSEHRGDKDYAMKM
LRRLGITDDQMKKNVQRLSGGQQQRVAIARTMVCDAKLVVADEPTGNLDEENTKYVIDQF
QKIAHEQKKCVIIVTHEPDVADVCDHSYRLEKHKFVAET
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtaaatgatcttggttactggtatgaccgccaagaaaatagtctatttgag
aatgtaaaccttgaatttaagtcggggacttcgtatgccattgttggtcaaagtggttcc
ggtaagacgaccttcctctcactgctggcgggtctagataaaccgcgggctgggcaaatt
gaactcaatggtgaaccaatcaataagattggtctgacgaactatcggaagtccaaagtg
gcaatcgtttttcaatcatataatttgttgacgtatatgtcaccattgaataatctgatg
actgccatggcaattacgaactcggaacaccgtggtgacaaggattatgcgatgaagatg
ttacgacggttaggtattacagatgatcagatgaagaagaatgttcaacgcttatctggt
ggtcagcagcaacgggtggcgattgcacggaccatggtgtgcgatgctaaactagtggtt
gcggatgaaccaaccggtaatttggatgaagaaaatacgaaatatgtgattgaccaattt
caaaaaattgcgcatgaacaaaagaagtgcgtcattattgtcacgcatgaaccggatgtt
gcggacgtttgtgaccactcctaccgattagaaaagcacaaatttgtggcggaaacctag

DBGET integrated database retrieval system