KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1235Help
Entry
LBP_cg1235        CDS       T02670                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lpr01001]
    LBP_cg1235
Enzymes [BR:lpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LBP_cg1235
Protein kinases [BR:lpr01001]
 Serine/threonine kinases: Other
  Bacterial family
   LBP_cg1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Haspin_kinase Seadorna_VP7 SfLAP Endonuc-EcoRV
Motif
Other DBs
NCBI-ProteinID: AGL63981
LinkDB All DBs
Position
1293871..1295895
Genome map
AA seq 674 aa AA seqDB search
MTPNYTLSGRYRIVRSLGEGGMANVYLAHDLILDRDVAVKLLRLDLRDDPKTIKRFQREA
LATTELVHPHIVSLYDIGEENGMQYLVMEYVKGMDLKNYIKENFPLPLQQVIDIMEQILS
AVATAHAHNIIHRDLKPQNILIDEQGNAKITDFGIAVALSEHTMTQTNTILGSVHYLSPE
QARGSMATKQSDIYSLGIILYEMLTGSVPFKGETAVSIALKHFQNAMPSVREFDADIPQA
LENVVLQATTKDPRERYATVEDMATDLLTVLASSRAGEKRFVPQDVGNDETKIMPSADIQ
AAIAANQDGKTQVVAHKSKQPTLQRPAETTESQTDADEEPLPTRSWSKRHPLRRRLLFWG
GIILLLVVAVIVGLELSRPQMTTVPKVTGLSQRAATKVLKKHHLTVGTVQHAKSNQVAKN
QVIKSTPSVKTRVQERARINLVISNGAKVMSFGNYVNDNYHDVRQTLKSAGFKVKETYST
SSVAAGQIISQDVVAGSRVMPTDTTVTFTVSAGSRYVELKDLTGESKSDILDYAEANDLN
VNFKQGYSSEQKAGYSYDQDPDGGGNVRTGSTITVTMSRGSDNNVTTPQNFYVKLTVPYK
ALSATTAQANDVKIYLYDDTHMIETVYRDIAIMRSTKISLPFQLTGNTKGHYRIVRNGVT
IMEKKNITSKNATK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaactatacccttagcggacgatatcggatcgttcggtccttaggtgaaggt
gggatggccaacgtttacttggcacatgacttaatattagatcgtgatgttgcggtcaaa
ctgctccggttagacttacgtgatgatcctaagaccatcaagcgattccaacgtgaggca
ctggcaacgacggaacttgttcacccccacattgtcagtttgtacgatattggcgaagaa
aatggcatgcaatacttggtcatggaatacgtcaaagggatggatcttaaaaattatatt
aaagagaactttccgttaccgttacagcaagtaatcgacatcatggagcagatattaagt
gccgtggcaacggcccacgcgcataatattattcatcgggatttaaaaccacaaaatatt
ttaattgatgagcagggcaatgctaaaatcactgatttcggtattgcggttgcgttatct
gaacataccatgacgcagactaacacgattttaggttcggtccattatttgtcaccggaa
caggcccgcggtagcatggcgacaaaacaatcggatatctattcgttagggattatttta
tatgagatgttaacaggctcagttcctttcaagggtgagacggcagtttccattgcgtta
aagcattttcaaaatgcaatgccatccgtgcgagagtttgatgcggatattccgcaggca
cttgaaaacgtcgtcttgcaggcgacaacgaaagatccacgggaacgttatgctacggtc
gaggacatggccactgacttattgacggtgcttgctagtagccgtgcgggcgaaaagcgc
tttgtaccgcaagatgtcggtaatgatgagactaagatcatgcccagtgcggatattcaa
gcagcaattgcggccaatcaagacggtaagacccaggtcgtggcgcataaaagcaagcaa
ccaacactccagcgcccggctgaaacgactgagagtcagacagatgctgatgaagaaccg
ttaccaacacgttcttggtccaaacgacatccgttgcggcgtcggctcctcttttggggc
ggtattattttgttattagtcgtggccgtgatcgtcggtttggaattaagtcggccacag
atgacgacggtgccgaaagtaacgggcttaagtcagcgtgccgcaactaaggtcctcaaa
aaacaccatctcacggtcggaactgttcaacatgctaaaagtaatcaggtagccaaaaat
caggtgatcaaatcaacgcccagtgttaagacgcgggtccaagaacgtgctcgcattaat
ttggttatcagcaacggtgccaaggttatgagctttggtaattatgtcaatgataattac
catgatgttcgacagacgcttaaatcggcggggttcaaagttaaggaaacttacagtacg
tcgtcggttgcagcaggacaaatcatcagtcaggatgttgtcgctggtagtcgcgtgatg
ccgacagatacgacggtgacgtttacggtcagcgctggtagccgctacgtcgagctaaaa
gatttaactggtgagagcaagagcgatattctggactatgctgaggcaaatgatcttaat
gttaactttaagcagggctactcttcggaacagaaggcaggttattcctatgatcaagat
ccagatggcggtggcaatgtccggactgggtcgactattacggtgaccatgtcaaggggc
agtgataataacgtgacgacaccacagaatttttatgttaaactaacggtgccatacaaa
gcgttatcggccaccactgcccaggccaacgatgttaagatttatttgtatgatgatacc
catatgattgagaccgtttatcgcgatattgcaatcatgcggtcgactaagattagttta
ccgtttcagctgaccggtaatacgaaggggcattaccgaatcgtgcgtaacggggttacg
atcatggaaaagaagaatattacaagcaaaaatgcaacaaaataa

DBGET integrated database retrieval system