KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1349Help
Entry
LBP_cg1349        CDS       T02670                                 

Definition
(GenBank) ABC superfamily ATP binding cassette transporter, substrate binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LBP_cg1349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpr02000]
    LBP_cg1349
Transporters [BR:lpr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    LBP_cg1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1 Rhomboid_N
Motif
Other DBs
NCBI-ProteinID: AGL64095
LinkDB All DBs
Position
complement(1405032..1406042)
Genome map
AA seq 336 aa AA seqDB search
MSKAAIITLSTLGVLAIGTSLYVNQHQKKTLTANAQTSQQVLTVYAAGPKPLSDQIIHGF
EAKTGIKVKSFDGTTGKILSKVKTEQGNPQADVLILASMAAGVDLQKNGQLLTYQPSQAK
HLNKQFKDTSHQLINYSASAVGITYNTQHIKSAPTDWSDLTTTPYRNQVTIPDPQTSGSS
LDFINAYQMKHGTQLLKALQENGADIGGANKEVLDAVITGQKIAVFGGVDYMSLTAIKKG
EKIGFVYPKSGTLVNPRPAMILKASRHQAAAKQFIDYLLSAKVQRQIQKSNLIPGTTSTL
TDPRNGEAIKAYTVNWTSANAALTKNVVAFNQVFSQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagcagcaattatcacattatccacgctcggcgtgctcgcaattggcacgtcg
ctttatgttaatcaacatcagaaaaaaacgttaaccgccaatgcgcaaaccagtcaacaa
gtcttaacagtatacgctgctggacctaaacccctttctgatcaaatcatccacggtttt
gaagccaaaactggcattaaagtcaaaagttttgacggcacgaccgggaaaattttaagt
aaggtcaagaccgagcaaggcaatccccaagctgatgtgctgattttagcttcaatggcc
gctggcgtcgatttacaaaagaatggccagctattaacctatcagccttctcaagctaaa
cacctgaataaacaatttaaagatactagccaccagttgatcaattacagtgcttcggca
gtcggcatcacctacaatacgcagcacatcaaatcggcaccgacagactggtctgacttg
acaaccactccgtatcgcaatcaagtgaccattccggacccccaaacctctggttctagc
ttggacttcattaacgcttatcaaatgaaacacggtacgcaactacttaaagcccttcaa
gaaaacggtgccgatatcgggggtgctaacaaggaagtactcgatgcagtcatcactggc
caaaaaatcgccgtctttggtggggtcgattacatgagtctaacagctattaaaaaaggc
gaaaaaattggtttcgtttatcctaagagtgggactttggtcaatccacgaccggcgatg
attttgaaggctagtcgtcatcaagccgctgccaaacaatttattgactatctcttatca
gctaaagttcaaagacaaattcaaaaaagtaacttaattccgggtaccacgagcactttg
accgatccacgcaatggcgaagccatcaaagcctacacggtcaattggaccagtgccaac
gcggccctgactaaaaacgttgtcgcattcaatcaggtctttagccaatga

DBGET integrated database retrieval system