KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2731Help
Entry
LBP_cg2731        CDS       T02670                                 

Definition
(GenBank) A/G-specific adenine glycosylase (Putative)
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LBP_cg2731
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpr03400]
    LBP_cg2731
Enzymes [BR:lpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     LBP_cg2731
DNA repair and recombination proteins [BR:lpr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LBP_cg2731
 Prokaryotic type
     LBP_cg2731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD NUDIX_4 HHH
Motif
Other DBs
NCBI-ProteinID: AGL65477
LinkDB All DBs
Position
complement(2800839..2801939)
Genome map
AA seq 366 aa AA seqDB search
MIEWDAATIKDFQTTLLDWFDHEGRDLPWRHDHEPYHVWVSEIMLQQTQVQTVIPYYQRF
MALFPTVADLAAAPESQLLKAWEGLGYYSRVRNMQRCAKQLLTDYDGQWPQTAAELTELI
GIGPYTAGAIASIAFNEPVPAVDGNAYRVFSRLLKIDADIAKPQTRAVFERVISQIISQE
RPGDFNQAIMDLGSSYMTARQPDTAHSPVKRFNQAYLDGDELAYPVKTKKPRPKPVAYVA
VLAKMQDQWLMTKRPSNGMLANLWTVPLIPIADLDLDDDYQPEELVTAVENYFKREYQLQ
LTAHYLTGRPVTHTFTHQKWTIQGLSGQVGLSDLAYFAGQTFTLIERQKLPMPKVQEKIF
ARYSID
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatgggatgcggcaacaattaaagattttcagacgacgctattagattggttt
gatcacgaaggccgcgatttaccatggcgacatgaccatgagccttaccacgtctgggtc
tctgaaattatgttacagcagacgcaggttcaaactgtgattccttattatcagcgcttt
atggcactttttccaacggtagcggacctagctgccgcacctgagtcacagttgttaaag
gcgtgggagggcctgggttattattcacgtgtccgcaatatgcaacggtgtgccaaacaa
ttgttaaccgattacgatggacagtggcctcaaactgccgctgagctgacggagttgatt
gggattggcccgtacactgcaggagcgattgccagcattgcgttcaatgaaccagttcca
gctgtggatggtaatgcctatcgcgtctttagccggttgctcaagattgacgcggatatt
gcgaagccccagacccgcgctgtttttgaacgggtaatcagtcagattatttcacaagag
cgacctggagattttaaccaggcgattatggacctcggttcaagctacatgacagcgcgg
caaccagatacggctcattcgccggtcaaacgctttaatcaagcttatttggatggggat
gagttagcctatccggtcaagacgaagaaaccgcggcccaagccggttgcttacgtggcg
gtattagctaagatgcaggatcagtggttgatgacgaagcgaccgagtaacgggatgttg
gctaatttatggacggttcccttgattccgattgcagatttagacttagatgatgattac
caacctgaagaactagttacggcggtagaaaattattttaaacgtgaatatcagctccag
ctaacggcccattatctgaccgggcggcctgtgacccatacgtttacgcatcagaagtgg
accattcaaggtttgagtggtcaagttgggttaagtgacttagcctactttgctggtcag
acctttacgttgattgagcggcagaaacttccaatgcctaaggttcaagaaaaaattttt
gcacgctattcaattgattaa

DBGET integrated database retrieval system