KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2780Help
Entry
LBP_cg2780        CDS       T02670                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00250  Alanine, aspartate and glutamate metabolism
lpr00430  Taurine and hypotaurine metabolism
lpr00650  Butanoate metabolism
lpr01100  Metabolic pathways
lpr01110  Biosynthesis of secondary metabolites
lpr01120  Microbial metabolism in diverse environments
lpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBP_cg2780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBP_cg2780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBP_cg2780
   00430 Taurine and hypotaurine metabolism
    LBP_cg2780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LBP_cg2780
Enzymes [BR:lpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LBP_cg2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGL65526
LinkDB All DBs
Position
2847395..2848804
Genome map
AA seq 469 aa AA seqDB search
MAMLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRL
NLATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTG
TSTIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQACWEKFCVYWDVDM
HMVPMDEQHMALDVDHVLNYVDEYTIGIVGIMGITYTGQYDDLAALDKVVTHYNRQHSKL
PVYIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLP
PELVFKVSYLGGELPTMVINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAA
LDKVGEFKMINNGHQLPLIYYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQV
IQRIVVRADFGMNMAHDFMDDLTKAVHDLNQAHIVYHHDAAPKKYGFTH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtcttt
ggtgcgccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcc
cctcgagaagccgatcgcttagttcgtgatgaactattagatgaaggcaattcacgactg
aacctggcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggat
acgctggctaagaatgccatcgataaatctgagtacccccgcacggccgagattgaaaat
cggtgtgtgaacattattgccaatctgtggcacgcgcctgatgacgaacactttacgggt
acctctacgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaatttgcc
tggcgtaaacgcgctcaagcggcaggcttagatttgaatgcccatcgacctaaccttgtt
atttcggctggctatcaagcttgctgggaaaagttttgtgtctactgggacgttgacatg
cacatggtcccaatggatgagcaacacatggcccttgacgttgaccacgtcttaaactac
gtggacgaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaatat
gacgacctagccgcactcgataaggtcgttactcactacaatcgtcagcattccaaatta
ccagtctacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccg
caactcatctgggacttccggttggctaacgtcgtttcgatcaacgcctccgggcacaag
tacggtttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccg
ccagaattagtcttcaaagttagttatttaggtggagagttgccgacaatggtgatcaac
ttctcacatagcgcagcccagctcattggacaatactataatttcattcgcttcggtatg
gacggttaccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgct
ctggataaagttggtgagtttaagatgatcaataacggacaccaactccctctgatttat
taccaactagccccgcgcgaagatcgcgaatggaccctttatgatttatcggatcgccta
ttaatgaacggttggcaagtaccaacgtatcctttacctgctaacctggaacaacaagtc
atccaacgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggat
gacctgaccaaggctgtccatgacttaaaccaagcccacattgtctatcatcatgacgcg
gcacctaagaaatacggattcacacactaa

DBGET integrated database retrieval system