KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2895Help
Entry
LPST_C2895        CDS       T01324                                 

Gene name
gutB
Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00040  Pentose and glucuronate interconversions
lps00051  Fructose and mannose metabolism
lps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LPST_C2895 (gutB)
   00051 Fructose and mannose metabolism
    LPST_C2895 (gutB)
Enzymes [BR:lps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LPST_C2895 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ADO00107
LinkDB All DBs
Position
complement(3113873..3114931)
Genome map
AA seq 352 aa AA seqDB search
MEAVVKTESGYDNMELKQIPIPEVTGDKVLLKVAYTGICGTDIHTFKGQYANAVTPLVLG
HEFSGEVVEVGPDVKTLKPGDRVTSETTFATDGTCVYCQDKEYNLCPNRVGIGTKANGSM
ANYVLTREESAHILPDNVSYKMAAMSEPLASCVHAMYQKTPFTLHDTLLIMGPGPMGLLS
LQIAKEIGAFVIVSGITKDADRLQIAKELGADIIVDTQKEDLAKVVMDATDGVGVTKVYD
CSGATPAVNSALPLIRKGGTFQQVGLFAKPMNELDERSIIQHEITYRGSRSQNPYDWAIA
LHLESKGAINQDAMITKVFDLEHWRDAFDAMMAGKELKVMIASNPDDPDLAD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtcgttaagacggaatctggttacgacaatatggaactgaagcaaattcca
atccctgaagtaacaggagacaaagttttattaaaagtggcctacactgggatctgcggt
actgatattcatacatttaagggtcagtatgccaatgcggtgacaccacttgttttgggc
catgaattttcaggtgaagttgttgaagtgggaccagatgttaaaacgctaaagcctggc
gatcgggtgactagtgaaacgacttttgcaacggatggcacatgtgtttactgccaagat
aaagaatataatttatgtcctaaccgtgtaggaatcggaactaaagctaatggttcaatg
gcaaattatgttctaactcgtgaggaaagtgctcacattttaccagataacgtttcctac
aagatggctgcaatgtcggaacctttagcatcttgtgttcatgctatgtatcaaaagaca
ccattcacgttacatgacactttattaattatgggaccaggaccaatggggctactctca
ttgcagattgccaaagaaattggtgcctttgttattgtttctgggatcactaaggatgct
gatcgtttacaaattgctaaagagttaggtgctgacattattgtagatacccaaaaagaa
gacttggccaaggtcgtgatggatgcgacagatggcgttggcgttaccaaggtttatgac
tgttcaggtgcaacgccagcggttaactctgcattaccattgatccgtaagggtggaact
ttccaacaggttggtctttttgcaaagccgatgaatgaattagatgaacgttcaattatt
cagcatgaaattacgtatcgtggctcacggtcacaaaatccgtatgattgggcgattgct
ttacatcttgaaagcaagggtgctattaaccaagatgcaatgattacgaaggtctttgat
cttgaacactggcgtgacgcttttgatgcaatgatggccggtaaagagctcaaagttatg
attgcctctaatcctgatgatccagatttagcagactaa

DBGET integrated database retrieval system