KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_00093Help
Entry
LPE509_00093      CDS       T02511                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Brite
KEGG Orthology (KO) [BR:lpu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LPE509_00093
Enzymes [BR:lpu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPE509_00093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase RTX_C
Motif
Other DBs
NCBI-ProteinID: AGH52184
LinkDB All DBs
Position
complement(91274..92452)
Genome map
AA seq 392 aa AA seqDB search
MHIKNIFTWNLMGAVILSMPLFAGEQVKLKSIDSLIDKYIEKYKNEELVTGVGATFLSGT
EIISTAHGFENNKRKKRLTNNAYFQIGSITKSFTAALILKLEAEGKLNINQTIGDWLPEY
DDWKGITIKQLLNMTSTIPGYATIPTLADSITDNPKKQWTSKELVDLAYGYKHPTSGYNY
SDTNYLILGMIIEKVTHDSFHNQLQKKILKPLQLKETYYITDSYTPYFLKKMPESYYYGR
TVENLKHGQKSTNDNLSMAGPAGAIVATTSDVAKWIKALFSSDFLLPKQQMELKSLISMK
TGTPISHVDSEEPNGFGLGVVQGYKPQLGKYWYYEGDTVGFRVLYIYHPCNEKIVVIALN
SSPFVDEAAGDHSGDLLLELYKNAFGISQKCE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaaaaatatattcacatggaatttaatgggcgcagtaattctatctatgccc
ttatttgcgggcgagcaagttaaattgaaatcaattgactcattaattgataaatacatt
gagaaatataaaaatgaagagctggttacaggtgtgggtgcgacttttttaagcggaact
gaaataatatcaacagcccatggttttgagaacaataaaagaaaaaaacgccttacaaat
aatgcatattttcaaattggcagtataaccaaatcgtttacagccgcattaatcttaaag
cttgaagcggaagggaaattaaacatcaaccaaacaattggagattggttgccagaatat
gatgactggaaaggcattactataaagcaattacttaatatgacaagtacaattccaggt
tatgcaacgattccaacgcttgcagattcgattactgataatcctaaaaaacagtggact
agtaaagaactggtagatttagcatatggatataaacaccccacctcaggttataattac
tctgataccaactacttaattctgggtatgattatagaaaaagtcactcacgattccttt
cataatcaattacagaaaaaaattctaaagcccttacaattaaaagagacctattatatt
actgattcttataccccatattttttaaaaaaaatgccggaaagttactattatggtaga
acagtggaaaacttaaaacatggtcaaaagtcaaccaatgacaatttatcaatggcggga
cctgctggtgctattgtcgcaactacatcggatgtcgccaaatggataaaagctttattt
tcatccgattttttactgccgaaacagcaaatggagttaaaatccctcatttcgatgaaa
acgggtactccaatctcccatgttgattcagaagagcctaatggctttggtttaggtgtt
gttcaaggctataagccgcaattgggaaaatattggtattatgaaggtgatacagtggga
tttagagtcttatatatttatcatccttgtaatgaaaaaatagtggttattgcattaaac
agttcgccttttgttgatgaagcagcgggagatcatagtggtgatttgttattggaattg
tacaaaaacgcttttggcatatcacagaaatgtgaataa

DBGET integrated database retrieval system