KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_02208
Entry
LPE509_02208      CDS       T02511                                 

Definition
(GenBank) putative membrane protein
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: AGH54299
LinkDB
Position
2348086..2349639
AA seq 517 aa
MIVFNPLSLYTTYLGWQQYEVLFNALWQTGLLYLGFLAIGYRFLKNVLNPAGAFYAVEHA
LNNFLYELAVTFLICSLFVYPCVPLETKALQFKPLCGLKNPTTAVIGDSGTTYDEAFADL
LTNQVKIPIGFAIIQNFMSSFTYSLMKVTGCTDSLQSIQGDLVSTYLPQNIRKQALDFHR
QCFIEARTKFNSEKHEASELDPMLKRYGGEDDLNWMGSKILQKMYYSKLHARQPVPGFTF
HQAPNRNLEKAANRGDIPPEQLPEDGYPSCQQWWHKIKADLVDVSNQASVFNKHLNYYAM
LDRVRKYKMKHPKAWKADISAEDFIAKMLLQESKDMQASSVQNLMDNNNGKVASAITHSL
VNVGQWTKSWTSTPLKREAIMQTLPVMQAFFMFFLIILTPMVLSLSCYSTRALGSLCALF
VMAIFLQYLWHLVGFLERSVLDPLGENDAISAMKNMAVMFYFVAPVLLLRLSSHFGGDAG
AGLMDLVNGSDRQSESMAQSGMHVAKTGVKIISKGIR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgattgtctttaatcctttatctctctataccacctatcttggttggcaacagtatgag
gttctatttaacgccctgtggcaaacagggctgttatatcttggttttttggccattggt
tatcgctttcttaagaacgtgcttaatccagctggcgcgttctatgcggttgaacatgct
ttaaataacttcctttatgaattggcagttactttcctaatatgcagcttattcgtctat
ccctgtgtgccgctagaaaccaaagccctgcaatttaaacccttatgtggattgaagaat
ccaacaactgcggtaattggcgacagcggaacaacttatgatgaagcctttgcagattta
ctaactaaccaggtcaagattcctataggctttgccatcatccagaacttcatgtcgagc
tttacttacagtctcatgaaggtaacgggttgcaccgacagtttgcaatccattcaaggc
gatttggtatcaacctatctgccacagaatattcgcaaacaagctctggattttcataga
caatgttttattgaagcaagaacgaaatttaatagtgaaaagcatgaagccagtgaatta
gatcccatgctaaaacgctatggtggtgaggatgatttaaactggatgggttctaaaatc
ctgcaaaaaatgtattacagcaaactccatgcacgccaacctgttcctggttttacattc
caccaagcccctaatcgcaatcttgaaaaagcggccaaccgtggcgatattccaccagaa
caactgccagaagacggttatcccagctgtcaacaatggtggcataagatcaaagcagat
ttggttgatgtttctaaccaagccagtgtttttaataagcacctaaattactacgccatg
ctagatagggttcgtaagtataaaatgaaacatcctaaagcctggaaagcagacatcagc
gcagaagattttattgccaagatgctcttgcaagaaagcaaagatatgcaggcaagctca
gtacaaaatctcatggacaataacaatggaaaggtcgcatccgcgattacccatagcttg
gtcaatgtcggacaatggacaaaatcatggacatctaccccattaaaaagagaagccatc
atgcaaaccttacctgtaatgcaggcgtttttcatgttctttttaatcattctcacccca
atggttttgtctttgagctgctacagcaccagagcattaggcagcctgtgcgccttattt
gtcatggctatttttcttcaatacctctggcatttagttggatttcttgaacgttcagta
cttgatccattaggtgaaaacgatgcgatttctgccatgaaaaatatggctgtgatgttt
tactttgtcgcaccagttttattgctgagattatcaagtcattttggcggtgacgctggg
gctggtcttatggatttggttaatggttcggataggcagagcgaaagcatggctcaatcc
ggtatgcacgtagccaagacaggagtaaaaattatttcaaaaggaattcgatga

DBGET integrated database retrieval system