KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_02800Help
Entry
LPE509_02800      CDS       T02511                                 

Definition
(GenBank) Glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
lpu00500  Starch and sucrose metabolism
lpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPE509_02800
Enzymes [BR:lpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LPE509_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: AGH54891
LinkDB All DBs
Position
2967435..2968718
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAVFYEMQANLINSRLKQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILINPQKEGVFAPHHTFVQNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSPNSINKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TTGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctcaccctcg
caatacaaccccaattattattatgactggattcgagactcagccattgccatgggattg
gttgaaacatggtatgaagccagccaatctgctcgatataaaaaacttttattagaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacggccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgat
cataatgaaatagattatgttaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcacatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttagctcaccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacttaattaacagtcgactgaaacagcatttggaccatcagaataaa
ataattcaagccacattattacctcaccccggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaattaacccacaaaaagaaggtgtttttgccccacatcac
acctttgtgcaaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcccggcgatacttatgatggc
taccaaacaaacagcatagggaacccctggtttatcttaaccgctacgatggctgaatat
tattttaccatggctcataatctgtccccgaacagcattaataaacttcatatacagaac
tatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagaacaattggaaaatagaataaaa
actacgggctggaatacctattag

DBGET integrated database retrieval system