KEGG   Limnobaculum parvum: HYN51_08355Help
Entry
HYN51_08355       CDS       T05491                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lpv  Limnobaculum parvum
Pathway
lpv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpv01100  Metabolic pathways
lpv01110  Biosynthesis of secondary metabolites
lpv01130  Biosynthesis of antibiotics
lpv01230  Biosynthesis of amino acids
Module
lpv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYN51_08355
Enzymes [BR:lpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     HYN51_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin Cytidylate_kin2 dNK AAA AAA_16 TsaE AAA_22 His_biosynth AAA_28 AAA_5 ABC_tran Ploopntkinase3 APS_kinase AAA_17 AAA_7 AAA_24 AAA_PrkA RNA_helicase AAA_29 RsgA_GTPase CoaE IstB_IS21 Mg_chelatase AAA_14 AAA_25 GTP_EFTU AAA_2
Motif
Other DBs
NCBI-ProteinID: AWH88566
UniProt: A0A2Y9TXZ6
LinkDB All DBs
Position
complement(3381790..3382308)
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQQLNMEFVDSDHEIERRTGADIAWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSKETRNRLSARGIVVYLETTIEKQLARTQRDKKR
PLLQVDTPREVLEALALERNPLYEEIADVTIQTDDQSAKVVANQIIQLIENR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctgatcggtcctatgggtgcaggtaaaagcacgata
ggtcgtcagttggctcaacagcttaatatggagtttgtagactccgatcacgagattgaa
cgccgtactggagctgatatagcctgggtattcgacgtagaaggcgaagaaggttttcgc
gatcgtgaagaaaaagttattaacgaactgacggaaaagcaaggcattgtcctcgcgact
ggcggcggttctgtaaaatcgaaagaaacccgtaatcgcttatccgcacgcggtattgtg
gtgtatttagaaaccacaatcgaaaagcagctggcgcgtactcagcgcgataagaagcgt
cctctgttgcaggttgatacaccgcgcgaagtgttagaagctttagcgttggaacgtaat
cctttatatgaagagattgccgatgtcaccattcagacggacgatcaaagcgctaaagtt
gttgcaaaccaaattattcagttaatcgaaaaccgctga

DBGET integrated database retrieval system