KEGG   Limnobaculum parvum: HYN51_10810Help
Entry
HYN51_10810       CDS       T05491                                 

Definition
(GenBank) hypothetical protein
Organism
lpv  Limnobaculum parvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_N FKBP_C
Motif
Other DBs
NCBI-ProteinID: AWH89005
UniProt: A0A2Y9TZ98
LinkDB All DBs
Position
219264..222689
Genome map
AA seq 1141 aa AA seqDB search
MMKCNNKRRYRFFFALILPLALPANAASLDEGIIGVRVRGEPSQSQASKPSSETESLNNR
SNLEQRATSPEVSTKASSKSQNELPRLRQQQAESVKQIAELERKISTLESALKLSKAKQS
ASASNVESVVPQDNKLNQQLVTLRSQLSDAESRLQVLQKTADAEKKQREQKQTQIDTLTK
QLTGDEQQKASLEKQLAELKAQHEKLQSNKTEEQKKQLSVSGAQITQIAALEKQLAESKA
RYEKQQGSNTEELKKQQTAFATQVNQIAALEKQLAESKAQRDKQQDSSAEELKKQQTASA
AQAKQIAALEKQLAESKAQHDKQQGSSAEELKKQQTAFATQVNQIATLEKQLAESKVLRD
KQQGSSAEELKKQQTAFATQVNQIATLEKQLAESKALRDKQQGSSAEELKKQQTASAAQA
KQIAALEKQLAESKAQHDKQQGSSAEELKKQQTASAAQAKQIAALEKQLAESKAQHDKQQ
GSSAEELKKQQTASAAQAKQITALEKQLAESKAQHDKQQGSSAEELKKQQTASAAQAKQI
AELEKQLAESKAQHDKQQGSSAEELKKQQTASAAQAKQIAALEKQLAESKAQHDKQQGSS
AEELKKQQTASAAQAKQIAELEKQLTESKTQRDKLQNSSTEEQKKQLAASVAQVAQIAAL
EKQLAGEKAQREILQGNSSEEQKKQQMAFAGQLKQITDLEKQLTEEKAQHEKLQTSGTAE
QKQQQVVLTGQLKQIADLEKQLAEEKAQHEKLQTSGTAEQKQQQVALTGQLKQIADLEKQ
LAEEKTQREKLQNSAGELVKQQALAAEQQQKVATLEKQLAEAKATPALNTEAQSKQQLAA
TSSLKEIEALKAQLSEEKLQHEQQKNRADTLVKQQIAGQELLAMFNKQVIAQQGLISTAA
NKSGELANKPVTDLENESKVKTAVAATGDKPTIPKSEDELVAYALGMQLGDKVQDSLAEN
AELGLSVNTNWALLGLVDTVKQQLQVDRGALLESLNKVSDTIRRNMRDKKQEAEKSGKQY
QKEFAAKPQVNKDPTGFHYRIEYGGDNKIPENANIMISVKESLVDGTIIEDMDVQRRYVT
QPLNKYPPVFRAALARLRDHGSMTLVVPPELAYGDRGLAPLIPPGSTILYSIRIVGVTTP
K
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatgcaataataagcgtcgttacagattttttttcgctctaattttacctttg
gctctacctgcgaatgcggcttcactggatgaaggcatcattggtgtaagggttcggggt
gagccttctcagagccaagcatccaagccttcttctgagacagaatctctgaataacaga
tctaatctggagcagagagctacatctccggaggtttccaccaaggcatcctccaaaagc
caaaatgagttaccgcgtttgaggcagcagcaggcggaatcggttaaacagattgctgaa
cttgaacggaaaatctcaacgcttgagtcagcgttaaaattatctaaagccaaacagtcc
gcatctgcatctaatgtggaaagtgttgttccgcaagacaataagcttaaccagcagtta
gtcacgctgagatcacaattatctgatgcagaatctcgcctgcaagtattacaaaaaacg
gcagatgcagaaaaaaaacagcgggaacaaaaacaaacccagattgatacgctaaccaaa
cagctgacaggcgatgagcagcagaaagcctcattggaaaaacaactggcagaattgaaa
gctcagcacgaaaaattacagagcaataaaacggaagaacagaagaagcagctatctgtt
tcgggcgcacagataactcaaattgctgcgcttgagaagcaactggccgaatcgaaagcc
cggtatgaaaagcagcagggcagcaatactgaagaactgaaaaagcagcaaacggccttc
gccactcaggtgaatcaaattgccgcgctggaaaaacagttggcggagtcgaaagcgcag
cgtgacaaacagcaggacagcagcgccgaagagctgaaaaagcagcaaacggcttcagcg
gctcaggcgaagcaaattgccgcgctggaaaaacagctggcggagtcgaaagcacagcat
gacaaacagcagggcagcagcgccgaagagctgaaaaagcagcaaacggccttcgccact
caggtgaatcaaattgccacgctggaaaaacagttggcggagtcgaaagtgctgcgtgac
aaacagcagggcagcagcgccgaagagctgaaaaagcagcaaacggccttcgccactcag
gtgaatcaaattgccacgctggaaaaacagttggcggagtcgaaagcgctgcgtgacaaa
cagcagggcagcagcgccgaagagctgaaaaagcagcaaacggcttcagcggctcaggca
aagcaaattgccgcgctggaaaaacagctggcggagtcgaaagcacagcatgacaaacag
cagggcagcagcgccgaagagctgaaaaagcaacaaacggcttcagcggctcaggcgaag
caaattgccgcgctggaaaaacagttggcggagtcgaaagcacagcatgacaaacagcag
ggcagcagcgccgaagagctgaaaaaacagcaaacggcttcagcggctcaggcgaagcaa
attaccgcgctggaaaaacagttggcggagtcgaaagcacagcatgacaaacagcagggc
agcagcgccgaagagctgaaaaagcaacaaacggcttcagcggctcaggcgaagcaaatt
gccgaactggaaaaacagctggcggagtcgaaagcacagcatgacaaacagcagggcagc
agcgccgaagagctgaaaaagcaacaaacggcttcagcggctcaggcgaagcaaattgcc
gcgctggaaaaacagctggcggagtcgaaagcacagcatgacaaacagcagggcagcagc
gccgaagagctgaaaaagcagcaaacggcttcagcggctcaggcgaagcaaattgccgaa
ctggaaaagcaattgaccgagtctaaaactcagcgagataagttacaaaacagcagtact
gaagagcagaagaaacagctggccgcttctgttgctcaagtggcacaaattgctgcatta
gaaaagcaactggcgggagaaaaagcccagcgagagatactgcaaggcaatagcagtgaa
gaacagaagaaacagcagatggcattcgcagggcaactgaagcaaatcactgacctggaa
aaacaactgactgaagagaaagcccagcacgagaagttacaaaccagcggtactgcagaa
cagaaacagcagcaggtggtgcttacagggcaactaaaacaaatcgctgatttagaaaag
cagttggcagaagagaaagcccagcacgagaagttacaaaccagcggtactgcagaacag
aaacagcagcaggtggcgcttacagggcaactaaaacaaatcgctgatttagaaaagcag
ttggcagaagagaaaacgcagcgcgaaaaattacaaaacagtgccggagagttagtcaaa
cagcaagcattagccgctgaacaacagcaaaaggtcgctactctggaaaaacagttggcg
gaagcgaaggctacgccagcgttaaatactgaagcgcagtctaagcagcaactggcagca
acctcgtcccttaaggaaattgaagcattaaaagctcagttgtctgaagagaagttgcag
catgaacagcagaaaaaccgcgcggatacgttggttaagcagcaaatcgccggacaagaa
ttgttggcgatgtttaataaacaagttattgctcagcagggattgatcagcaccgcagca
aataaatcgggtgaactcgctaataagccggtcaccgatttagaaaatgaatcaaaagta
aaaacagcagtagcagcaacgggcgataagccaaccattcctaaaagtgaagatgaattg
gttgcctatgcgctgggtatgcaactgggggataaggttcaggattcattggcggaaaat
gctgagttagggttgagtgttaacactaattgggcgctgcttggtctagtcgatacagtg
aagcagcagctacaggtagatcgtggtgcactgcttgagagtctgaataaagtcagcgat
accattcgccgtaatatgcgggataaaaagcaagaggcggaaaaaagtggtaagcaatat
caaaaagagtttgcagcaaaacctcaggtaaataaggacccaacaggttttcattatcgt
attgaatacggtggagataataagatacctgagaacgccaatatcatgatttcagtaaaa
gagagcttggttgacggcacgattatcgaagatatggatgtccagcgccgctatgtgact
cagccgctgaataaatatcctccggtattcagagctgcactggctcggttacgcgatcat
ggcagtatgacgctggtggtgcctcctgaattagcctatggcgatcgaggtttggctccg
ttgattccaccgggttcaaccatcctatatagcatccgaattgtcggtgtcactacgccg
aagtaa

DBGET integrated database retrieval system