KEGG   Limnobaculum parvum: HYN51_14045Help
Entry
HYN51_14045       CDS       T05491                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
lpv  Limnobaculum parvum
Pathway
lpv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpv01100  Metabolic pathways
lpv01110  Biosynthesis of secondary metabolites
lpv01130  Biosynthesis of antibiotics
lpv01230  Biosynthesis of amino acids
lpv02024  Quorum sensing
Module
lpv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYN51_14045
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HYN51_14045
Enzymes [BR:lpv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     HYN51_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AWH90116
UniProt: A0A2Y9U1Y9
LinkDB All DBs
Position
981095..982162
Genome map
AA seq 355 aa AA seqDB search
MQKDVLNNVNISAEQVLITPEELKARYPLSASDEVNISAARQTIANILHGRDDRLLVVCG
PCSIHDPDAAIDYAHRLKKLADETQDRLYIVMRVYFEKPRTTVGWKGLINDPHMDGSFDM
EHGLHLARQLLLKLVEMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLGTAINAMKAASMPHRFMGINQSGQVCLLQTQGNPNGHIILRGGKTP
NYEAEHVQDCEEQMRKAGLNPALMIDCSHGNSNKDFRRQADVVYSLLEQIKAGNRSIIGM
MLESNIHEGNQSSEQPRADMCYGVSVTDACINWETTDTLLRKVHEELKVKTLVCP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagatgtacttaacaacgtcaatatcagtgcggagcaggttttaattacacca
gaagaactgaaagcacgatacccgctgagcgccagtgacgaagtcaatatttctgcagct
cgccagactatcgccaacattttacacggccgtgacgatcgtttgttggtggtgtgtggg
ccttgctcgattcacgatcctgatgccgctatcgattatgcacatcgcctgaagaaactg
gctgatgaaacacaggatcgcctgtacatcgtgatgcgggtttacttcgaaaagccaaga
accaccgtaggctggaaaggattaattaacgatccccatatggatggctcatttgatatg
gagcatggcttacaccttgcccgtcaattattgctgaagctggttgaaatgggattgccg
ctggcaaccgaggcgcttgatccaaatagcccgcaatacttaggcgacctgttcagttgg
tcagccattggggcgcgcacaaccgaatcacaaacccaccgcgaaatggcatctggcctg
tcgatgccggttggttttaaaaatggtaccgacggcagcctaggaaccgcgattaatgcg
atgaaagccgcttctatgccgcatcgctttatgggaattaatcaatcaggtcaggtttgt
ctgttgcaaacgcagggcaatccaaatggtcatatcattctgcgcggtggtaagacacca
aactacgaagcggaacacgtacaggattgtgaagagcaaatgcgtaaggctggacttaac
ccggcgttaatgatcgactgtagccacggtaactccaataaagatttccgccgtcaggct
gacgtagtctactccttgctggaacaaattaaggccggtaaccgttctattattggaatg
atgctggaaagcaatattcatgaaggcaatcaatcatcggaacagccaagagctgacatg
tgctatggcgtatccgtaaccgatgcctgcatcaactgggaaactaccgacaccttatta
cgcaaagtacatgaagaactgaaggtaaagaccttagtttgtccgtga

DBGET integrated database retrieval system