KEGG   Limnobaculum parvum: HYN51_14435Help
Entry
HYN51_14435       CDS       T05491                                 

Definition
(GenBank) sulfate/thiosulfate ABC transporter ATP-binding protein CysA
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
lpv  Limnobaculum parvum
Pathway
lpv00920  Sulfur metabolism
lpv02010  ABC transporters
Module
lpv_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    HYN51_14435
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HYN51_14435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpv02000]
    HYN51_14435
Enzymes [BR:lpv01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     HYN51_14435
Transporters [BR:lpv02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    HYN51_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N TOBE_3 AAA_23 AAA_16 AAA NACHT AAA_29 AAA_22 RsgA_GTPase SbcCD_C VirE AAA_14 AAA_24 AAA_18 TniB AAA_30 AAA_33 T2SSE Rad17 AAA_28 AAA_19 TsaE DEAD cobW
Motif
Other DBs
NCBI-ProteinID: AWH89640
UniProt: A0A2Y9U1F3
LinkDB All DBs
Position
1074054..1075148
Genome map
AA seq 364 aa AA seqDB search
MSIEIKGINKYFDQTRVLQDISLDIHSGEMLALLGPSGSGKTTLLRIIAGLEYQSSGLLS
FNGKDVSRLHARDRQVGFVFQHYALFRHMTVFDNVAFGLTVLPRRERPTAAVIKQKVEGL
LEMVQLSHLANRFPSQLSGGQRQRVALARALAVDPQILLLDEPFGALDAQVRKELRTWLR
QLHEELKFTSVFVTHDQEEAMEIADRVVVMSQGHVEQVGTPEAVMREPESRFVLEFLGEV
NQIKAEIKGHRLLVGSHHWPLDVSPIHQGAVELYLRPWEVELSAQPTSRCVLPVQVMDSI
PKGHYWQLTLQPSGWQQAPLSVTFSHEHGAPPQKGERYYIGGERARLYAGDKLLLQSYPY
AKSA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgagattaaaggtattaataaatactttgaccaaaccagagtcttgcaggac
atctctctggatatccattccggtgaaatgctggcgctgctggggccatctggctcagga
aaaacgacgctgttgagaattattgccgggctggagtatcaaagctccggtctgttaagt
tttaatggtaaagatgtgagccgccttcatgctcgggatcgtcaggtcggttttgtattc
cagcactatgcgttattccgccatatgacggtgtttgataatgtcgcctttggcttgacg
gtgctgcctcgccgtgaacgcccaacggcagcggtaattaaacaaaaggttgaagggctg
ctggaaatggtacaactgagccatctggcaaatcgcttcccttcccaattatccgggggg
cagcgtcaacgggtggcattggcgcgtgcgctggcggtagatccacaaatcttattactg
gatgaaccctttggtgcgttagatgctcaggttcgtaaagagctgcgtacttggctgcgt
cagttgcatgaagagctaaaatttaccagtgtatttgtgactcatgaccaagaagaagcg
atggaaattgccgatcgcgtggtggtaatgagccaagggcatgttgagcaggttggtaca
cctgaagcggtgatgcgcgaaccggaaagtcgctttgtgctggagtttcttggggaagtt
aaccagattaaggcggaaattaaaggtcatcgtttgctggtgggatcgcatcactggccg
ttggacgtatcgccaatacatcagggggcggtggagctttatttacgcccgtgggaagta
gagctaagtgcacaaccgacatctcgttgtgtattgccggtacaggtgatggacagcata
ccaaaaggccattactggcagctcacattgcaaccgtcaggctggcaacaagcgccactt
agcgttacctttagtcatgaacatggcgcaccaccacaaaaaggcgagcgctactatatc
ggaggagagcgggcgcgtctgtatgccggggataagttgttgttgcaaagctatccctac
gcaaaaagcgcctga

DBGET integrated database retrieval system