KEGG   Lactobacillus paraplantarum: ASU28_08090Help
Entry
ASU28_08090       CDS       T04156                                 

Definition
(GenBank) phosphohydrolase
Organism
lpx  Lactobacillus paraplantarum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpB NUDIX
Motif
Other DBs
NCBI-ProteinID: ALO04315
LinkDB All DBs
Position
complement(1737787..1738740)
Genome map
AA seq 317 aa AA seqDB search
MQPIQLTTYQSDWQKQATEYQTLLRQQLQANLLKSSHVGSTAMPQLLARPTIDLALLVKD
QAAAVATLHARPVAGTTHTYATKLAANDIHVIITTDEQHYQQLLTFRDYLNAHRTDGRKY
TAIREKGVRNGQADLAAYLQTKAAFMASINDKAQDWLATKDQHEHHDRTVRAELVNMCLI
TNPKTGDVLVENKIDAQWSGLTFPGGHVDRGESQVAAMKREVLEETGLSVDQLKLVGTVT
WVENEDGDVSLGTLYTTSHYHGDLLAGSYEGAISWQPLDQLTPDKLAPGVDQILKVFTDG
HANEAFWGFDDDQLRVY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattcaattaaccacctatcaatctgactggcaaaaacaagcaaccgagtat
caaaccttgttacgccagcaattacaggcgaatctattaaaaagtagtcacgtgggtagt
acggccatgccccaattattggcgcgtccaacgattgacctagcactgcttgttaaagat
caggcggctgccgtagctacgttacacgcacgaccggtcgccggaacgacacacacttac
gcaacaaaattagctgctaacgacatccacgttatcattacaactgatgaacagcattat
cagcaattgctcacttttcgggattatctcaatgcgcaccggacagacggccgcaagtat
actgccattcgcgaaaaaggtgtgcgcaatgggcaagccgatctcgcagcctacctacaa
acgaaagcagcattcatggccagcatcaatgacaaggcccaagactggttagccactaag
gatcagcatgaacaccacgaccggaccgttcgggcagaactcgtcaacatgtgcctaatt
accaaccccaagactggcgacgtcctcgttgaaaataaaatcgacgctcagtggtcaggc
ctgactttccccggcggccacgtcgatcgtggggaatcccaagttgcggcaatgaaacgc
gaggtcttagaagaaaccggtctaagtgttgatcaattaaaattagttgggactgtcact
tgggtcgaaaacgaagacggcgacgtgtcacttggcaccttatacactaccagtcactat
catggtgatttattagccggttcatacgaaggggctattagctggcaaccattagaccaa
ctaacacccgataaattagcacccggtgttgaccaaattctgaaagttttcactgacggt
cacgctaacgaagcattctggggttttgatgacgatcagctccgcgtgtactaa

DBGET integrated database retrieval system