KEGG   Lactobacillus paraplantarum: ASU28_13635Help
Entry
ASU28_13635       CDS       T04156                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lpx  Lactobacillus paraplantarum
Pathway
lpx00250  Alanine, aspartate and glutamate metabolism
lpx00430  Taurine and hypotaurine metabolism
lpx00650  Butanoate metabolism
lpx01100  Metabolic pathways
lpx01110  Biosynthesis of secondary metabolites
lpx01120  Microbial metabolism in diverse environments
lpx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASU28_13635
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASU28_13635
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASU28_13635
   00430 Taurine and hypotaurine metabolism
    ASU28_13635
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASU28_13635
Enzymes [BR:lpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ASU28_13635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALO05591
UniProt: A0A098R8U0
LinkDB All DBs
Position
2938496..2939899
Genome map
AA seq 467 aa AA seqDB search
MLYGKHNHEAEEYLEPVFGAPSEQHDLPKCRLPKHSLAPREADRLVRDELLDEGNSRLNL
ATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPSNEHFTGTS
TIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAQRPNLVISAGYQVCWEKFCVYWDIDMHV
VPMDEQHMALDVDHVLDYVDEYTIGIVGIMGITYTGQYDDLVALDKVVSHYNNHHPKLPV
YIHVDAASGGFYTPFIEPQLTWDFRLANVVSINASGHKYGLVYPGVGWIIWRDRQFLPPE
LVFKVSYLGGELPTMAINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLATALD
KLGEFEMINDGHQLPLICYQLAPRDSREWTLYDLSDRLLMNGWQVPTYPLPANLEQQVIQ
HIVVRADFGMNMAHDFIDDLTKAVHNLNQAHIVYHRDEAPKRYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttatatggtaaacataatcatgaagctgaagaatatttggagccagtctttggtgcc
ccttccgaacaacacgatcttcccaagtgtcgcttaccaaagcattcactagcaccaagg
gaagctgatcgcttagttcgtgatgaattattagacgaaggcaattcgcgactaaatctg
gcaactttttgccagacctatatggaacctgaagccgttgaattaatgaaagatacgcta
gctaagaatgccatcgacaaatcagagtatccccgtacggctgaaatcgaaaatcgttgc
gtcaatattattgctaatctgtggcatgcccctagtaatgaacacttcacgggcacctcc
acgattggttcttccgaagcctgtatgttaggcggcttagccatgaaattcgcctggcgt
aaacgtgctcaggcggcgggattagatttgaacgcacagcgaccaaatctcgttatttcg
gccggctatcaagtttgttgggaaaaattctgtgtctattgggatattgatatgcacgtc
gttccaatggacgaacaacatatggcccttgatgttgaccacgtcttagactacgttgac
gaatacacgattggcatcgtcggtattatgggtatcacgtacactggccaatatgatgac
ttagtggctcttgataaagttgtttctcactataataaccaccatcctaaactccccgtc
tatattcacgttgacgccgcatcgggaggcttttacacgcccttcattgaaccacaactc
acttgggattttagattggcgaacgttgtgtcaatcaacgcctccggtcacaaatatggc
ctagtctatccaggcgttggctggattatctggcgtgatcgccagttcttaccaccagaa
ttagtcttcaaagtcagttatctaggtggagaactgcccacaatggccatcaacttttcc
cacagtgctgcccaactgattggccaatactataattttatccggttcggcatggatggt
taccgtgaaatccaaaccaaaactcacgatgtcgctcgatacctcgcaactgcgctggac
aaattaggtgaattcgaaatgattaatgacggccatcagttgcccctaatctgctatcaa
ttagccccccgcgacagtcgtgaatggacactctacgacctatcggaccgcttattaatg
aatggctggcaagtaccaacttatcccttacctgctaatttagagcaacaagttattcaa
catatcgtcgtccgagccgactttggtatgaatatggctcacgattttattgatgatttg
actaaagccgttcacaatttgaatcaagctcacattgtctaccatcgtgatgaagcacca
aaaaggtacggctttacgcactga

DBGET integrated database retrieval system