KEGG   Luteibacter pinisoli: FIV34_19060Help
Entry
FIV34_19060       CDS       T06035                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
lpy  Luteibacter pinisoli
Pathway
lpy00860  Porphyrin and chlorophyll metabolism
lpy01100  Metabolic pathways
Module
lpy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:lpy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FIV34_19060
Enzymes [BR:lpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     FIV34_19060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: QDE41153
UniProt: A0A4Y5ZAG8
LinkDB All DBs
Position
complement(4181135..4181674)
Genome map
AA seq 179 aa AA seqDB search
MSIHLLRHGDTGHRSYRGQLDDPLTELGWSQLRAAVEGQAWDRIVSSPLVRCAHFAEELA
AKRAIPLRLDARLVEYHFGAWQGVSMETLAAGQGDALGRFWKDPVTYPPPGAETFDAFGA
RLSAAMDDIASEVHGARTLVVTHGGAIRLLRCLAEQRPLADMAGFDVPHASLHGIHWGH
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccacctccttcgccacggcgatacggggcatcgcagctatcgcggccagctc
gatgatccgttgaccgaactcggctggtcgcagttacgggccgccgtggaagggcaggca
tgggaccggatcgtgtcgtcgccgctcgtgcgctgcgcgcacttcgcggaagagctggca
gcgaaacgcgccataccgctacggctcgatgcgcgtctggtggagtatcacttcggcgcc
tggcaaggcgtgtcgatggaaacactggcggccgggcagggcgacgcactcggccggttc
tggaaggatccggtgacgtatccaccgccaggcgcggaaaccttcgacgccttcggggcg
cggctgtctgcggcgatggatgacatcgcgagcgaagtccacggcgcgcgcacgctggtc
gtcacccacggcggcgcgatccgcctcctgcgctgcctggccgagcagcggccactcgcc
gacatggccgggttcgacgtaccgcacgcgtcgttgcacggcatccactggggacactga

DBGET integrated database retrieval system