KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_112Help
Entry
LRHK_112          CDS       T01961                                 

Definition
(GenBank) aspartate kinase domain protein
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00260  Glycine, serine and threonine metabolism
lra00261  Monobactam biosynthesis
lra00270  Cysteine and methionine metabolism
lra00300  Lysine biosynthesis
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01210  2-Oxocarboxylic acid metabolism
lra01230  Biosynthesis of amino acids
Module
lra_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
lra_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHK_112
   00270 Cysteine and methionine metabolism
    LRHK_112
   00300 Lysine biosynthesis
    LRHK_112
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    LRHK_112
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     LRHK_112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7
Motif
Other DBs
NCBI-ProteinID: AER62969
LinkDB All DBs
Position
115623..117002
Genome map
AA seq 459 aa AA seqDB search
MRVVKFGGSSLADGAQFAKVVAIMKANPDRQVIVTSAPGKRHPGDVKVTDLLIKYAQAVL
QQGETAAIVAEIVARYQAIATAFNLDAQVMEKIENELYQLPNTSFKNADYLMAGFKARGE
KLNAFLMTAVLNHEGIEATYGEPKTLGIVVTDHPNDAEVSRETYDRLAAFRRPLGVLVVP
GFYGYTSDGDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIQE
MTYREMRELSYGGFGVFHDEAILPAIAGQIPINLKNTNHPSAPGTMIVPEQHFVPKHAIT
GIVSSQHFGAIYLHRYLLNKEVGFTLKLLQVLARHGISYEHMPSGIDDLTIILDDRQLTE
AKRKAICAEIQEVVHPDVLKWIDDYAIIMVVGEGMAQRTGLIQTILQPLASAGVHVSMIN
EGASQISLMLGTSRESANRAVKAIYNAFFIPINQRLEVQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgtcgtaaaatttggcggttcgtcattagcagatggagcgcagtttgccaaggtt
gtggcgattatgaaggcgaatccggatcggcaggttatcgtaaccagtgcgcctggtaaa
cggcatcccggcgatgtcaaggtgacagacctgctaatcaagtacgcccaagcggtgttg
cagcagggtgaaacggctgcaatcgttgctgaaattgtggctcggtatcaggccattgcc
acggcgttcaaccttgacgcgcaagttatggaaaaaatcgaaaatgaactataccagtta
ccgaataccagctttaaaaatgccgactacctaatggctggcttcaaggcacgaggcgaa
aaattaaatgcttttctcatgacggcagttttgaaccacgaaggtatcgaagccacgtat
ggtgaaccgaaaactttaggaattgttgtaactgatcatcccaatgatgctgaggtttca
cgtgaaacttacgatcgtttggcggcatttcggcggccactgggtgtgctggtggtaccg
ggattttatggctataccagtgatggtgatattgctactttttcacgtggcggctcggat
attaccggtgcgattttagcaaacgggtttcatgccgacctgtatgaaaacttcaccgat
gtagatggcgttgcggctgctgatccacgggtggtggcaaatccgcagatgattcaagaa
atgacgtatcgggaaatgcgggagttgtcatatggcggctttggcgtttttcatgatgaa
gcgattctaccggccattgcgggacagattccgattaatttaaaaaatacgaatcatcct
tctgcccctgggacgatgattgtcccggaacaacattttgtgccgaaacatgcgattacc
ggcattgtcagctcacaacattttggcgcgatctatctgcatcgttatttactcaataag
gaagtcggatttacgctcaagctgctgcaggttttggcgcgacatggcatcagttatgag
catatgccaagcgggattgacgatttgaccattattttggatgatcggcagctcacagag
gcgaaacgtaaggccatttgtgctgaaattcaggaagttgtacacccggacgttttgaag
tggattgacgattatgcgattatcatggtggtaggtgaagggatggcacaacgaaccgga
ttgattcagacgattttgcagccgctagcgagcgccggcgtgcatgtgtcgatgattaat
gaaggggcctcccagatttcattgatgcttggcacatcgcgggaatcggcgaatcgagca
gtcaaggccatctataacgcctttttcattccgatcaatcagcgtttggaggtgcagtga

DBGET integrated database retrieval system