KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2801Help
Entry
LRHK_2801         CDS       T01961                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00065  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase [EC:1.1.1.127]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00040  Pentose and glucuronate interconversions
lra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LRHK_2801
Enzymes [BR:lra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.127  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
     LRHK_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR CHASE2 UPF0113_N
Motif
Other DBs
NCBI-ProteinID: AER65519
LinkDB All DBs
Position
2719299..2720123
Genome map
AA seq 274 aa AA seqDB search
MSEIHQTEEEIRQHEEELDHFKMTQFNLNGKVAIITGGNTGLGQGYAVAMAEAGADIFIP
TFGRAEWDNTRRLIEKRGQKVAFMEVNLTEPGSAEKVVKEALKQMGHIDILVNNAGMIRR
NPLLESKDKDWDQVIAINLSAVYHLSLEVSKVFAQQKSGKIINIGSMLSFQGGKYIPSYT
ASKHGVAGLTKAFASEMGPYNVQINAIAPGYIKTENTAPVRADKNRNDDILSRIPAGHWG
EPYELMGIAVFLASDAANYINGAIIPVDGGFLVS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaattcaccaaactgaagaggaaattcgtcaacatgaagaagaactggaccat
tttaagatgacccaatttaatcttaatggtaaagtcgcaattattacgggtggaaataca
ggattaggtcaaggttatgctgttgcaatggcagaagccggagcggatattttcattcca
acttttggccgagcagaatgggataacacacggcggttaatcgaaaaacgtggtcaaaag
gttgcgttcatggaggttaatctaactgagccaggaagtgctgaaaaagtcgttaaggaa
gcactaaagcagatgggccatatcgatattttggtcaacaatgcgggtatgatccggcgt
aatccattattagaatcaaaagacaaagactgggatcaggttatcgcgattaatctcagc
gctgtgtaccatttgtctctagaagtttcaaaagtattcgcccaacaaaagtcaggaaaa
atcatcaatattggctccatgctctcgttccaaggcggtaagtatattccctcttatact
gcaagtaagcatggtgttgccggcttaacaaaggcgtttgcttccgaaatgggtccttat
aatgtgcagattaacgctattgcacccggctatattaagacggaaaacacagcacctgtg
cgcgccgataagaaccgcaatgatgatattcttagtcgtattcctgcgggacattggggt
gaaccctatgagttaatggggattgcagtctttctggcaagcgatgccgcaaattacatt
aatggtgccatcatccctgttgacggtggtttccttgttagctga

DBGET integrated database retrieval system