KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2841Help
Entry
LRHK_2841         CDS       T01961                                 

Definition
(GenBank) xylose isomerase-like TIM barrel family protein
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00040  Pentose and glucuronate interconversions
lra00053  Ascorbate and aldarate metabolism
lra01100  Metabolic pathways
lra01120  Microbial metabolism in diverse environments
Module
lra_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LRHK_2841
   00053 Ascorbate and aldarate metabolism
    LRHK_2841
Enzymes [BR:lra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     LRHK_2841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF4862
Motif
Other DBs
NCBI-ProteinID: AER65558
LinkDB All DBs
Position
complement(2758257..2759144)
Genome map
AA seq 295 aa AA seqDB search
MISLGIYEKALPRTESWVERLKMVRDLGFNFLELSVDESVERLARLDWTAAKRAKVRDAC
WQTGVRIHTLMLSGHRRFPLGSADPAIREKSLTMLCKAIDLASDLGVRNVQLAGYDVYYE
PKTLASREYFIENLKRGVAYAAAKEVMLAIETMDDPFLNSLSKIKTIKDEIPSPWLQAYP
DLGNLSAWPENNVGRELELGIANIVSVHLKDTQAVTAKSKGQFRDVPFGAGVVDFAGCLR
TLKRLDYSGAFTIEMWTEKAADPIQEVKQAKDFFDPLFVQAGFVQEPVAKTNVPS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcactaggaatttacgaaaaagcactgcccaggaccgaatcttgggttgaacgg
ttgaaaatggttcgggatttgggtttcaactttttggagttatcggttgatgaaagtgtc
gaacggttggcccggttggattggacggcagcgaaacgggcgaaggtgcgtgatgcttgt
tggcaaacaggggtgcggatccatacattgatgttaagcggccatcgtcggtttccatta
ggctcggcagacccggcgatccgtgaaaaaagtctgacgatgttatgtaaggcgattgat
ttggctagtgatctgggcgttcgcaatgttcaactagccggttatgacgtttactatgag
ccgaaaaccttagcttcacgagaatattttatcgagaacctgaagcgcggtgtggcctat
gccgcggctaaagaagtgatgctggcaattgagacgatggacgatccgtttttgaattca
ctttccaaaattaagacgattaaagatgagattccgagtccgtggttgcaagcgtatccg
gatcttggcaacttgtcagcctggccggaaaacaatgtcggtcgcgagcttgaactgggg
attgcaaacatcgtctcggttcatttgaaggatacccaagcggtgacggcaaaaagcaaa
gggcaattccgcgatgtcccgtttggcgctggcgtggtggactttgccggttgtctgcga
acgctaaaacgccttgattacagcggcgcctttacgatcgagatgtggacggaaaaggcc
gctgatccaatccaagaagtgaagcaggccaaggactttttcgatccgctgtttgtgcag
gctggttttgttcaggagccggtggcaaaaaccaatgtcccatcatga

DBGET integrated database retrieval system